Details for Lyrate rockcress Locus 16055636

Position : sca3 ( 5`- 10435272 .. 10437620 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479814 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16055636

Protein [Map View]
MLTKVETKVVEPKFACPLCNNRFKDATTISECLHTFCRSCIRNKFINERVKACPVCNVNLGVFPLHKLRSDYSWQSLKLK
VDRAKTERVKAASVKSSKKKGKSLTSPVVSSSRVSSSPDTPLKPPIVVVEPPIVVVEEKHRETVQALQSSRKPIITFKKR
GRKSSLPKKFDSKPEPELPPKEPEIKNFFDLNNEPEDNGLDEAEGSTCQEFIPKENDLCKSLDAKEVAPLNINDTPPVIV
EPVLSSDGDTEESVEPIHNKCVVNRETEEVPIQVNKKTVLISSDRDTEDNSGQKLKSNGATSRSRRKKGKKPVEKSYSLR
PRKDGRTINSAANNTTPEVAVTVEEEKKVEGRNTNAVWFSLMPSKTQNIEMLLPPINARCIRVKDRNMTVSYLKKYLMVK
LGLESEDQVEVWLRNEPLCSSLTLHSLVDWWVQTTPLPERRSAMVGSSAADFLMNLHYSFKSDASGSGSGSGSGFGSGSD
SE*

DNA
ATGCTAACAAAGGTGGAGACGAAAGTGGTTGAGCCAAAATTTGCTTGTCCGCTCTGCAACAATCGGTTTAAGGATGCCAC
CACAATCTCCGAGTGTCTTCACACATTTTGCAGGAGCTGCATTCGTAACAAGTTCATAAATGAGAGAGTGAAAGCTTGTC
CAGTCTGCAACGTTAACCTCGGTGTTTTTCCTCTACATAAACTTCGGTCGGATTACAGTTGGCAAAGTTTGAAGCTGAAA
GTCGACCGGGCAAAGACGGAAAGGGTTAAGGCAGCCTCTGTGAAATCTTCGAAAAAGAAGGGAAAATCTCTAACTTCACC
AGTGGTCTCTTCATCTAGAGTATCATCCTCACCTGATACTCCATTGAAACCACCCATTGTGGTTGTGGAGCCACCCATTG
TGGTTGTGGAGGAGAAGCATAGGGAGACCGTACAAGCTCTTCAAAGCTCTCGTAAACCGATAATCACATTCAAGAAACGT
GGAAGAAAATCTTCACTCCCCAAGAAGTTTGATTCGAAACCGGAACCCGAACTGCCTCCTAAGGAGCCTGAAATTAAGAA
TTTCTTTGATCTGAACAACGAACCTGAAGACAATGGATTGGATGAAGCTGAAGGATCGACATGTCAAGAATTCATACCAA
AGGAGAACGATCTTTGTAAGTCCTTGGATGCTAAGGAAGTAGCGCCACTAAACATCAACGATACTCCTCCTGTTATCGTT
GAGCCAGTGTTAAGTTCGGATGGCGATACAGAGGAATCTGTTGAACCTATTCACAACAAGTGTGTCGTGAATAGGGAAAC
AGAGGAAGTCCCTATTCAAGTGAATAAAAAAACTGTCCTTATTAGCTCTGATAGGGATACAGAGGACAACTCTGGTCAGA
AACTGAAGAGCAATGGTGCTACCTCCAGATCAAGGAGGAAGAAAGGGAAGAAACCGGTGGAAAAGAGTTATTCTTTGAGA
CCCCGAAAAGACGGGAGGACGATTAATTCAGCAGCTAATAATACTACACCAGAAGTTGCGGTTACCGTGGAAGAGGAAAA
GAAAGTTGAAGGACGTAACACCAATGCAGTTTGGTTTTCGTTAATGCCTTCCAAGACTCAGAACATTGAAATGCTACTTC
CACCGATCAACGCTCGCTGCATAAGAGTGAAAGATAGAAACATGACTGTCTCATATCTCAAGAAGTATCTAATGGTGAAG
CTCGGTCTCGAAAGCGAAGACCAAGTGGAGGTATGGCTAAGGAATGAGCCATTGTGTTCGTCACTGACGCTACATAGCTT
GGTGGATTGGTGGGTCCAAACTACTCCATTGCCTGAGCGACGAAGCGCCATGGTCGGAAGCTCCGCTGCTGATTTCCTCA
TGAATCTCCATTACAGCTTCAAATCTGACGCCTCTGGCTCTGGCTCTGGCTCTGGCTCTGGCTTTGGCTCTGGCTCTGAC
TCTGAATAA