Details for Lyrate rockcress Locus 16055624

Position : sca3 ( 5`- 10341527 .. 10342831 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16055624

Protein [Map View]
MPFTMKIQPIDIDSSPAVARAESGNKPVLKSRLKRLFDRPFTRNATTTTEKPFVTGGEVQCSGGGGVVTEFEPSSVCLAK
MVQNFIEENNEKQAKCGRNRCNCFNGNNDSYSDDESDLFGGSIDGCDASDHLKSLVPCATVDERNLLADAAKIVDKNKSV
KRKDDMKKIVNEGLLSLNYNSSICKSKWDKSPSFPAGEYEYIDVIIGEERLIIDVDFRSEFDIARQTSGYKALLQSLPFI
FVGKSDRLSQIVFLISEAAKQSLKKKGMHFPPWRKAEYMRSKWLSSYTRASVVVGDVDEKPETETDVAVVTADTAQREVD
SVVEIELVFEEKCLSPRVNIINSSSSPNDGDDDVAVEREVKALTGLASLFKEKP*

DNA
ATGCCATTTACGATGAAGATCCAACCGATTGATATAGATTCTTCTCCAGCTGTAGCTAGAGCTGAATCAGGCAACAAACC
TGTGCTCAAATCTCGTCTCAAACGTTTGTTTGATCGACCGTTCACGAGAAACGCAACAACAACCACAGAGAAACCATTCG
TCACCGGTGGTGAAGTTCAATGTAGCGGCGGCGGCGGAGTAGTGACGGAGTTCGAACCAAGCTCTGTTTGCTTAGCGAAG
ATGGTTCAGAACTTCATAGAAGAAAACAACGAGAAACAAGCTAAATGTGGACGTAATCGTTGCAATTGCTTTAACGGTAA
CAACGATAGCTACTCCGATGATGAATCAGATCTATTCGGTGGTTCAATTGACGGTTGCGACGCTTCTGATCATCTCAAGA
GTTTGGTTCCGTGCGCAACCGTCGACGAGAGGAATCTGTTAGCCGACGCGGCGAAGATTGTAGATAAGAACAAATCGGTG
AAACGAAAAGACGATATGAAGAAGATCGTCAACGAAGGACTCTTATCACTTAATTACAATTCTTCAATCTGCAAATCTAA
ATGGGATAAATCTCCTTCGTTCCCAGCTGGTGAATATGAGTATATAGATGTGATAATCGGAGAAGAAAGGTTAATAATCG
ATGTAGATTTCCGATCAGAGTTCGATATAGCGAGACAAACGAGTGGTTACAAGGCGTTGCTTCAATCTCTACCGTTCATT
TTCGTCGGGAAATCTGATCGGTTAAGTCAGATCGTGTTTTTGATATCGGAGGCGGCGAAACAGAGTTTGAAGAAGAAAGG
AATGCATTTTCCGCCGTGGAGGAAAGCTGAGTATATGCGATCTAAATGGTTATCTTCTTATACACGAGCTTCTGTTGTCG
TCGGAGATGTTGATGAGAAGCCGGAGACGGAGACGGATGTTGCGGTGGTGACGGCGGACACGGCGCAGAGGGAGGTGGAT
AGTGTTGTAGAGATTGAGCTGGTTTTTGAGGAGAAATGTTTATCTCCGAGAGTGAATATTATTAATTCTTCCTCCTCTCC
AAACGACGGCGATGATGACGTGGCGGTGGAGAGAGAAGTGAAGGCTCTCACCGGATTAGCTTCACTCTTTAAGGAAAAGC
CCTAA