Details for Lyrate rockcress Locus 16055574

Position : sca3 ( 5`- 5357661 .. 5362136 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16055574

Protein [Map View]
MASSPGNTSPHNPPPFDLSTIFKPSSNPYPPPTGPFLNNQQLYAPPGIAAQPSPVNQTQQDASSSSSATNLHPQRTLSYP
TPPLNPQSPRVNHNPGTHILALLNNNNNGGALANQEPSHQLPVVNHNEIARSFPGGSGPIRVPSGKMPKGRRLVGEHAVY
DVDVRLQGEIQPQLEVTPITKYGSDPQLVVGRQIAVNKVYICYGLKGGNIRVLNINTALRSLFRGHSQRVTDMAFFAEDV
HLLASVSLDGKVFVWKISEGSEGDDQPEITGKIVLALQILGEEDTKHPRVCWHCHKQEILVVSIGKHVLRIDTTKVGRGE
VFSAEAPLQCPLDKLIDGVQIVGKHDGEVTDLSMCQWMTTRLVSSSVDGTVKIWQDRKAQPLVVLRPHDGHPVNSATFVT
SPERPDHIILITGGPLNREMKIWVSAGEEGWLLPADTESWRCTQTLDLKSSSEPRAEKAFFNQVIVLPEAGLLLLANARR
NAIYSVHLDYGASPVDTRMDYLSEFTVTMPILSFIGTNDHPEEPIVKVYCVQTLAIQQYTVDLCLCMPPPRENVGFEKSD
SSVSREANLVESTSEPPGIKPTELPSADSVPKPSILVNRSESADTLSFPAGSASAEVTPPAIVPPNSDPKTSGMPSETSD
TGSAYAPSPQLSLSPRLSSKLSGYHTPVEAIEQVLPRHELGGKTSSADYSYDRQIDDVGERNLDVSSVEENCRRKDTNVT
PDDDLSGIRSPSAFFKHPTHLVTPSEILMGVSSTEASIATEDKRDRDANIQDVNNDARGLEVEVKEVGEARTSQNGEINY
HETTENHTSESRENIFCSQASNLSTEMARDRHPITEDTVIPGDSMTYVQPFQSGDERGLDSRDVSAKLPESGSSSGPLQS
PATTSKGKKQKAKNSQGPGLSSTSSNVANLADSFNDRSHPMTDSLAQLLAMQETMNQIMASQKEMQRQLSNAVTGPIVKE
GKKLEVALGRMIEKSSKSNADALWARFQEEAVKNEKALRDHGQQIVNATTNFMSKELNAMFEKTMKKEFAIVAPTLARAV
TPVIEKTVSSAITESFQRGIGDKAVNQLEKSVNSKLETTIARQIQAQFQTSGRQALQLL*

DNA
ATGGCTTCTTCACCTGGTAATACTAGCCCTCACAATCCTCCTCCGTTCGATCTCAGTACTATCTTCAAACCCTCATCGAA
CCCTTATCCTCCGCCTACAGGTCCTTTTCTTAACAATCAGCAACTCTACGCGCCGCCTGGTATCGCCGCCCAACCATCTC
CGGTGAATCAGACGCAACAGGATGCGTCTTCCTCTTCCTCCGCTACTAACTTGCATCCACAGAGAACGCTATCTTATCCC
ACGCCACCTCTGAATCCCCAATCTCCCCGTGTTAATCACAATCCAGGAACGCACATCCTCGCTCTCCTCAACAATAACAA
CAACGGAGGCGCCTTGGCTAACCAGGAGCCGTCGCATCAGCTCCCGGTAGTGAATCACAACGAGATCGCTCGGTCTTTTC
CCGGCGGTTCGGGTCCTATTCGTGTTCCAAGCGGTAAAATGCCCAAAGGAAGGCGATTGGTCGGTGAACATGCGGTGTAC
GATGTGGATGTGAGATTACAAGGTGAGATTCAGCCGCAGCTGGAGGTGACTCCGATTACCAAATACGGCTCGGATCCTCA
GCTTGTAGTCGGTAGGCAAATCGCCGTCAATAAGGTCTACATTTGCTATGGATTGAAAGGAGGAAACATACGGGTTCTCA
ATATCAACACAGCATTAAGGTCTCTATTCCGTGGACATTCTCAGAGAGTGACGGACATGGCTTTCTTTGCCGAAGATGTT
CATCTCTTGGCTAGTGTTAGTCTAGATGGAAAAGTTTTCGTGTGGAAAATTTCCGAAGGATCTGAGGGAGATGATCAACC
CGAGATAACTGGAAAGATCGTTCTTGCTCTTCAGATACTAGGAGAGGAAGACACCAAACATCCACGTGTTTGTTGGCACT
GCCACAAACAGGAAATTTTGGTAGTTTCAATTGGTAAACATGTGCTGCGAATTGATACCACAAAAGTTGGCAGAGGTGAA
GTATTCTCTGCTGAGGCACCACTCCAGTGTCCCCTTGATAAACTGATTGATGGTGTTCAGATTGTGGGTAAGCATGATGG
AGAAGTTACTGATTTATCAATGTGCCAATGGATGACCACGCGCCTGGTTTCTTCTTCAGTTGATGGCACGGTCAAGATAT
GGCAAGATCGTAAGGCACAACCACTTGTAGTTTTGAGACCTCATGATGGACATCCAGTCAATTCAGCCACATTTGTAACA
TCCCCGGAAAGACCTGATCACATCATACTTATCACGGGGGGTCCTCTAAATCGAGAAATGAAAATTTGGGTCTCAGCTGG
GGAAGAAGGGTGGCTTCTACCAGCTGATACTGAATCATGGAGGTGTACCCAGACACTTGATTTGAAAAGTTCATCTGAGC
CACGAGCTGAAAAGGCATTTTTCAACCAAGTTATAGTATTGCCTGAAGCAGGCCTGCTTTTACTTGCAAATGCGAGAAGG
AACGCCATATATTCCGTGCATTTGGACTATGGCGCTTCTCCAGTTGATACGCGGATGGATTACCTGTCAGAGTTTACAGT
GACTATGCCTATATTGAGTTTTATTGGGACAAATGATCATCCAGAAGAACCAATTGTTAAGGTTTATTGTGTTCAGACTC
TAGCAATCCAGCAGTATACAGTAGACTTATGCTTGTGCATGCCACCTCCTAGAGAGAATGTGGGTTTTGAGAAGTCAGAT
TCTAGTGTGTCACGGGAGGCAAACCTTGTTGAAAGCACGTCAGAACCACCTGGAATTAAGCCTACCGAATTACCTTCAGC
TGATTCAGTGCCTAAACCATCTATTTTAGTGAATAGATCGGAAAGTGCTGATACACTGAGTTTTCCAGCGGGTTCTGCAT
CAGCAGAGGTCACACCACCAGCAATTGTTCCACCCAACAGTGATCCTAAAACTTCTGGGATGCCTTCTGAGACCAGTGAT
ACAGGTTCTGCGTATGCTCCTTCACCTCAACTTTCTCTAAGTCCCAGACTATCAAGTAAACTTTCTGGCTATCACACTCC
TGTAGAAGCAATTGAGCAAGTACTACCACGTCATGAGCTTGGTGGGAAAACAAGTTCTGCTGATTATTCTTATGATAGGC
AAATTGATGATGTTGGAGAAAGAAATTTGGATGTGTCTTCTGTTGAGGAAAACTGTAGAAGAAAGGACACGAATGTTACA
CCTGATGATGATTTGTCTGGGATTCGAAGCCCGTCAGCTTTTTTCAAACACCCCACTCATCTCGTAACTCCTTCAGAGAT
ATTGATGGGCGTTTCGTCCACTGAAGCCTCCATTGCTACTGAAGACAAGAGAGATAGAGATGCAAATATTCAGGATGTGA
ATAATGATGCAAGAGGCTTAGAAGTTGAGGTGAAAGAAGTAGGCGAAGCACGGACTTCACAGAATGGTGAAATCAACTAT
CATGAAACAACTGAGAATCACACTTCAGAAAGTAGAGAAAATATCTTCTGCTCACAGGCTTCAAATCTCAGCACTGAGAT
GGCAAGAGACCGTCATCCTATTACAGAGGACACTGTCATTCCAGGGGACTCTATGACTTATGTACAACCTTTTCAATCTG
GGGATGAAAGGGGTCTTGACTCAAGAGATGTGTCTGCAAAGCTTCCTGAGTCGGGTTCATCTAGTGGGCCTCTACAGTCG
CCAGCTACGACTAGCAAAGGGAAGAAGCAGAAGGCCAAAAATTCACAGGGCCCCGGTTTGTCATCTACATCCTCAAATGT
TGCTAATCTGGCTGACTCCTTCAATGATCGAAGTCATCCCATGACAGATTCACTTGCTCAGTTGTTAGCAATGCAAGAAA
CAATGAATCAGATAATGGCTTCGCAGAAGGAGATGCAGAGACAACTATCAAATGCTGTCACTGGCCCTATCGTAAAAGAA
GGTAAAAAACTAGAAGTGGCCTTAGGGAGAATGATTGAGAAATCCAGCAAGTCAAATGCTGATGCTCTATGGGCCCGCTT
CCAAGAGGAGGCTGTTAAGAATGAAAAGGCATTACGTGACCATGGCCAGCAAATTGTGAATGCAACGACAAACTTCATGA
GCAAGGAGTTAAATGCCATGTTTGAGAAAACGATGAAAAAGGAATTTGCTATAGTTGCTCCAACCCTAGCACGTGCAGTA
ACTCCAGTTATTGAAAAAACTGTATCTTCTGCAATCACAGAGTCCTTCCAGAGAGGAATTGGTGACAAAGCAGTCAATCA
GCTTGAAAAATCTGTTAATTCAAAGCTTGAAACAACCATAGCCAGGCAAATTCAAGCCCAATTTCAGACATCTGGCAGAC
AAGCCCTCCAGTTGTTGTAA