Details for Lyrate rockcress Locus 16055570

Position : sca3 ( 5`- 6159974 .. 6158355 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16055570

Protein [Map View]
MSGRNRGPPPPSMKGGSYNGLQAPVHQPPFVRGLGGGPVPPPRPSMIDDSREPQFRVDARGLPPQFSILEDRLAAQNQDV
QGLLADNQRLAATHVALKQELEVAQHELQRMMHYIDSLRAEEEIMMREMYDKSMRSEMELREVDAMRAEIQKVRADIKEF
TSGRQELTSQVHLMTQDLARLTADLQQIPTLSAEIENTKQELQRARAAIDYEKKGYAENYEHGKIMEHKLVAMARELEKL
RAEIANSETRAHAAAPVGNPGGVAYGGGYGNPEAGYHVNPYQPNYVMNPAQAGVIGYYPPPYGQQAAWAGGYDPQQQQQQ
QQQPPQGHR*

DNA
ATGTCTGGAAGAAATCGTGGACCTCCTCCTCCTTCAATGAAAGGTGGATCTTACAATGGCTTACAAGCTCCGGTTCATCA
ACCGCCTTTTGTTAGAGGGTTAGGAGGAGGACCTGTGCCTCCTCCTCGTCCTTCTATGATTGATGATAGTAGAGAACCTC
AATTTAGAGTGGATGCAAGAGGTCTTCCTCCACAGTTTTCGATTTTGGAGGATCGTCTCGCTGCTCAGAATCAAGATGTG
CAGGGTTTACTTGCTGATAACCAGAGGCTAGCTGCGACTCATGTTGCGCTAAAACAGGAGCTAGAAGTTGCTCAGCATGA
ATTGCAAAGAATGATGCATTACATTGATTCCTTGAGAGCTGAGGAAGAGATTATGATGAGGGAGATGTATGATAAATCTA
TGCGATCCGAAATGGAATTACGTGAAGTCGATGCTATGCGAGCTGAGATTCAGAAGGTCCGTGCGGATATCAAAGAGTTT
ACTTCAGGTAGGCAAGAACTAACGAGTCAGGTTCACTTGATGACTCAAGATTTGGCTAGACTTACAGCAGATTTGCAGCA
GATACCAACACTATCTGCAGAAATTGAAAACACAAAGCAAGAGCTGCAACGCGCAAGAGCGGCTATTGATTATGAGAAGA
AAGGGTACGCTGAAAACTACGAGCATGGCAAAATTATGGAGCATAAATTAGTTGCAATGGCTCGGGAACTGGAGAAGCTT
CGAGCAGAGATTGCTAACTCAGAAACGAGGGCTCATGCAGCTGCTCCTGTTGGGAATCCTGGTGGAGTTGCTTATGGTGG
TGGCTATGGAAATCCTGAGGCTGGGTATCATGTGAATCCTTATCAACCCAACTATGTCATGAATCCAGCACAAGCAGGCG
TTATTGGCTATTATCCTCCTCCATACGGACAGCAGGCTGCGTGGGCTGGTGGCTATGATCCGCAACAACAGCAGCAGCAG
CAGCAGCAGCCACCACAAGGTCATCGATGA