Details for Lyrate rockcress Locus 16055567

Position : sca3 ( 5`- 7507329 .. 7505068 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479235 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16055567

Protein [Map View]
MKGLVSTGWKGPVKFRMPTAENLVPIRLDIQFEGQRYKDAFTWNPSDPDNEVVVFAKRTVKDLKLPSAFITQIAQSIQSQ
LSDFRAYEGQDMYTGEKIIPIKLDLRVNHTLIKDQFLWDLNNFESDPEEFARTLCKDLGVEDPEVGPAVAFAIREQLYEI
AIQSVASARESRLSKKGRRGSDHGSASKASGLSMDLMKLFSFKSSVVRKRKDLDVYEPVVDLLTSEEVDALEARAERHAR
*

DNA
ATGAAGGGTTTAGTGTCTACTGGTTGGAAAGGTCCCGTCAAGTTTAGGATGCCCACTGCTGAAAACTTGGTACCAATTCG
TTTGGACATTCAATTCGAGGGTCAGCGTTATAAAGATGCTTTCACTTGGAACCCTTCAGACCCGGATAATGAAGTCGTTG
TCTTTGCCAAAAGAACTGTTAAAGACTTGAAACTGCCCTCTGCATTTATCACTCAGATTGCCCAATCTATTCAGTCTCAG
CTCTCAGACTTTCGGGCATATGAAGGACAAGATATGTACACTGGTGAAAAAATCATACCAATTAAGCTTGATCTCCGAGT
TAACCATACCCTCATCAAGGATCAGTTCTTGTGGGACCTAAACAATTTTGAGAGTGATCCTGAGGAATTCGCAAGAACCT
TGTGCAAGGATTTAGGTGTTGAAGATCCTGAAGTTGGACCTGCTGTTGCCTTTGCAATAAGGGAACAACTTTACGAGATT
GCAATTCAAAGTGTGGCTTCAGCTAGGGAGAGTCGATTAAGTAAGAAAGGCCGCAGAGGATCTGATCATGGTTCAGCCAG
CAAGGCAAGTGGCTTGTCAATGGACTTAATGAAGTTATTCAGCTTTAAGTCCAGTGTAGTTCGGAAAAGGAAAGACTTGG
ATGTTTATGAACCAGTTGTGGATCTGCTAACAAGTGAGGAAGTTGATGCCCTTGAAGCCAGGGCAGAGAGGCATGCAAGG
TAA