Details for Lyrate rockcress Locus 16055539

Position : sca3 ( 5`- 5072848 .. 5069180 -3` )
Annotation : [B2G] enhancer of ag-4 1
External links : CoGe
PGDD synteny : 16055539

Protein [Map View]
MAHRQLYSYALQPSYAAASAVSPAPPPQQQPPKTGLSSLYGSSADHYYPDTTFRFLARDGSEALSNYSGTLASSSAMYHH
LPNTTASHLAYPQLLQHQEAAWPPGVEVPGAASAVEPLPPGVKRTSEALYYPTLLGAHNTIGQTEAWYTTDYFTKRPKLE
STSHLPIYPQRAGEKDCTHYMQTRTCKFGDSCKFDHPIWVPEGGIPDWKEAPVVPNEEYPERPGEPDCPYYIKTQRCKYG
SRCKFNHPREEAAVSVETQDALPERPSEPMCTFYMKTGKCKFGLTCKFHHPKDIQVPSSSQDNGSSVGLTSEPDATNNPH
VTFTPALYHNSKGLPVRPGEVDCPFYLKTGSCKYGATCRYNHPERTAFIPQATGINYSLVSSNTANLNLGMVTPATSFYQ
TLTQPTLGALSATYPQRPGQSECDYYMKTGECKFGERCRFHHPADRLSATSNQASQQPNVKLSLAGYPRREGALNCPYYM
KTGTCKYGATCKFDHPPPGEVMAKTTSEADAAGATDTTQ*

DNA
ATGGCACATCGTCAATTGTATAGCTACGCTCTTCAACCTTCTTACGCTGCTGCCTCCGCCGTATCTCCAGCTCCTCCGCC
GCAACAGCAGCCGCCAAAAACCGGTCTTTCCTCTCTCTACGGTTCTTCTGCTGACCATTATTACCCCGATACCACGTTTC
GTTTCTTAGCTCGCGATGGATCCGAAGCTTTGAGCAACTATTCAGGGACTCTTGCATCGTCCTCCGCTATGTACCACCAT
TTGCCTAACACGACGGCATCGCATTTGGCGTATCCGCAGCTGCTTCAGCATCAGGAAGCAGCTTGGCCACCTGGTGTGGA
GGTTCCCGGTGCTGCTTCCGCCGTCGAGCCACTTCCTCCTGGTGTCAAACGCACCTCTGAAGCGCTCTACTATCCGACTC
TGTTGGGTGCCCATAATACAATTGGTCAAACCGAAGCTTGGTATACTACAGACTATTTTACCAAGCGCCCTAAGTTGGAG
AGTACAAGCCATTTGCCTATATATCCACAGAGGGCAGGAGAGAAGGATTGTACCCACTATATGCAAACAAGAACATGTAA
ATTTGGAGATAGCTGCAAGTTTGATCATCCTATTTGGGTTCCTGAGGGCGGAATCCCAGATTGGAAAGAGGCACCAGTTG
TTCCAAATGAAGAGTACCCTGAGAGACCAGGAGAACCAGATTGTCCTTACTATATAAAAACCCAACGCTGCAAATATGGT
TCAAGGTGCAAATTTAATCATCCGAGAGAAGAGGCTGCAGTTAGTGTTGAAACCCAAGATGCATTGCCTGAGAGGCCTTC
TGAACCTATGTGCACATTCTACATGAAGACTGGAAAATGTAAATTTGGTTTAACATGCAAATTCCACCATCCAAAGGATA
TCCAGGTACCATCATCTAGTCAGGATAATGGTAGCAGTGTGGGGTTAACCAGTGAGCCTGATGCCACAAACAATCCGCAT
GTCACATTTACCCCAGCATTGTATCATAACTCGAAAGGACTGCCTGTTAGACCGGGTGAAGTGGACTGCCCATTCTATCT
CAAAACCGGAAGCTGCAAGTATGGAGCCACTTGTCGCTACAATCATCCTGAGAGGACTGCATTTATCCCCCAAGCTACTG
GGATAAACTATTCTCTAGTTTCGTCGAACACTGCGAATTTAAACCTTGGGATGGTTACACCAGCTACCTCCTTCTACCAG
ACTCTTACTCAACCCACGCTTGGAGCGCTTTCAGCAACTTATCCCCAAAGACCTGGACAATCAGAATGTGATTACTACAT
GAAGACAGGGGAGTGCAAGTTTGGAGAGAGATGCAGGTTCCATCACCCAGCAGATAGGTTAAGTGCAACGAGCAATCAAG
CTTCTCAACAACCAAATGTAAAGCTGAGTCTTGCAGGGTATCCCAGAAGAGAGGGTGCGCTTAATTGCCCTTATTACATG
AAGACAGGGACTTGCAAATACGGGGCAACATGCAAGTTTGACCATCCTCCTCCAGGTGAGGTGATGGCTAAGACCACTTC
AGAAGCCGATGCTGCTGGAGCAACCGACACTACTCAATGA