Details for Lyrate rockcress Locus 16055408

Position : sca3 ( 5`- 22204914 .. 22201499 -3` )
Annotation : [B2G] kinase family protein
External links : CoGe
PGDD synteny : 16055408

Protein [Map View]
MTIKDESESCGSRAVVASPAQENPRHYRMKLDVYSEVLQRLQESNYEEATLPDFEDQLWLHFNRLPARYALDVKVERAED
VLTHQRLLKLAEDPATRPVFEVRSVQVSPRSSADSDPAVEEDAQSSHQPSGQGVLAPPTFGSSPNFEAITQGSKIVEDVD
SVVNATLSTRPMHEITFSTIDKPKLLSQLTSLLGELGLNIQEAHAFSTVDGFSLDVFVVDGWSQEETDGLKDALSKEILK
LKDQPGAKQKSISFFEHDKSSNELIPACIEIPTDGTDEWEIDVTQLKIEKKVASGSYGDLHRGTYCSQEVAIKFLKPERV
NNEMLREFSQEVFIMRKVRHKNVVQFLGACTRSPTLCIVTEFMARGSIYDFLHKQKCAFKLQTLLKVALDVAKGMSYLHQ
NNIIHRDLKTANLLMDEHGLVKVADFGVARVQIESGVMTAETGTYRWMAPEVIEHKPYNHKADVFSYAIVLWELLTGDIP
YAFLTPLQAAVGVVQKGLRPKIPKKTHPKVKGLLERCWHQDPAQRPLFEEIIEMLQQIMKEVNVVV*

DNA
ATGACGATCAAAGACGAGTCGGAGAGTTGCGGTAGTAGAGCCGTCGTTGCTTCGCCGGCTCAAGAAAACCCTAGACATTA
CCGGATGAAACTTGATGTCTACAGTGAGGTTTTACAACGACTTCAAGAATCTAATTACGAAGAAGCTACTCTTCCTGATT
TCGAGGATCAACTTTGGCTCCATTTCAATCGTCTTCCTGCTCGATATGCTCTTGATGTTAAAGTTGAGAGAGCGGAAGAT
GTTCTTACTCATCAGAGATTACTAAAATTGGCGGAAGATCCTGCAACTAGGCCTGTCTTTGAAGTTCGTAGTGTACAGGT
TTCTCCTAGAAGCTCTGCTGACTCTGACCCTGCGGTGGAGGAAGATGCTCAAAGCTCTCACCAACCAAGCGGACAGGGGG
TTCTTGCTCCTCCAACTTTTGGTTCTTCTCCAAATTTTGAGGCTATTACTCAGGGAAGTAAAATTGTTGAAGATGTTGAT
AGTGTTGTGAATGCAACATTGTCTACTCGACCAATGCACGAGATCACATTTTCAACCATCGATAAACCGAAACTCCTTAG
CCAGCTAACTTCCCTGCTTGGTGAGCTTGGACTGAATATACAAGAGGCTCATGCTTTTTCCACTGTAGATGGTTTCTCTC
TAGATGTCTTTGTAGTTGATGGTTGGTCTCAGGAGGAAACAGATGGTCTAAAGGATGCATTGAGCAAAGAGATATTGAAG
CTTAAGGATCAACCTGGTGCAAAACAGAAATCTATTTCTTTCTTTGAGCATGACAAATCAAGCAATGAGCTTATACCCGC
CTGCATTGAAATACCCACGGATGGAACTGATGAGTGGGAAATTGACGTGACACAGCTCAAAATTGAAAAGAAAGTGGCAT
CTGGTTCATATGGGGATCTGCATAGAGGCACTTATTGCAGTCAGGAAGTAGCTATCAAATTTCTCAAGCCTGAGCGTGTA
AACAATGAGATGCTTAGAGAATTTTCTCAAGAAGTTTTTATAATGAGGAAAGTTCGACACAAAAATGTCGTTCAATTTTT
GGGTGCATGCACAAGATCTCCAACCCTCTGTATAGTGACTGAGTTTATGGCTCGAGGGAGCATATATGATTTTCTTCACA
AACAGAAATGCGCTTTCAAACTTCAAACTTTGCTTAAAGTTGCACTTGATGTGGCAAAAGGAATGAGCTATTTGCATCAA
AACAACATTATTCACAGGGACCTTAAGACTGCAAATCTTCTTATGGATGAACATGGACTTGTCAAGGTTGCTGATTTCGG
AGTTGCCAGAGTGCAGATTGAATCAGGAGTCATGACAGCTGAAACAGGGACTTACCGGTGGATGGCTCCAGAGGTCATTG
AGCACAAACCTTACAATCACAAGGCAGATGTGTTCAGTTATGCGATAGTGCTATGGGAACTTCTGACTGGTGACATCCCA
TATGCTTTCTTGACTCCACTACAAGCAGCTGTTGGCGTTGTCCAAAAGGGGCTTCGACCGAAAATTCCAAAGAAAACCCA
CCCAAAAGTGAAAGGACTTCTAGAGAGATGCTGGCATCAAGACCCGGCACAGAGACCACTGTTTGAGGAAATCATAGAAA
TGCTACAACAGATAATGAAAGAGGTAAACGTCGTAGTGTGA