Details for Lyrate rockcress Locus 16055348

Position : sca5 ( 5`- 17979760 .. 17977306 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16055348

Protein [Map View]
MCEKARVIVRMLQGCNSMNKLRKIHSHVIINGLHHHPSIFNHLLRFCAVSVNGSLSYAQLLFDRFDSDPSTSAWNYLIRG
FSISSSPLYTILYYNRMLLSSVSRPDIFTFSFALKACERIRLIPKCLELHGSVIRSGFLADAIVSTNLVRCYSANGSVEI
ASKVFDEMPVRDLVSWNAMISCFSHAGLHHQAFSMYSRMANEGVCVDAYTIVALLSSCAHVSALNMGVMLHRIACDIRCE
SSVFVCNALIDMYAKCGSLENAVGVFKGMRKRDVLTWNSMIIGYGVHGHGVEAISFFRKMVASGVRPNAVTFLGLLLGCS
HQGLVKEGVEHFEIMSSQFHLTPNVKHYGCMVDLFGRAGQLEKALEMIHTSSCHEDPVLWRTLLGSCKIHRNLELGEVAM
KKLVQLEAFNAGDYVLMTSIYSAANDAQGFASMRKLIRSHDLRTIPGWSWIEIGDQVHKFVIDDKMHPESALIYSELGEV
INRAILAGYKPEDSNRTAHTLSDRCLESADTSHSEKLAIAYGLMRTTAGTTLRITKNLRVCRDCHSFTKYVSKAFNREII
VRDRVRFHQFAGELIVIRVLYSLGVLLKLSPQDSLKGKVRETGDETIIDTEVVIMVWNKNITETRKSTKEKEESKPQKLQ
RLESILWDCNT*

DNA
ATGTGCGAGAAAGCGAGAGTGATAGTGAGAATGCTACAAGGCTGCAACAGCATGAACAAGCTCCGTAAGATTCATTCTCA
TGTCATCATCAATGGTCTCCATCATCATCCTTCCATCTTCAACCATCTCCTCCGCTTCTGCGCCGTCTCCGTCAACGGCT
CTTTGTCTTACGCTCAGCTTCTCTTCGACCGTTTCGATTCTGATCCATCTACGTCGGCTTGGAACTACCTTATTCGTGGC
TTCTCCATATCTTCTTCTCCTCTTTATACGATTCTCTACTATAATCGAATGCTTCTCTCCTCTGTTTCACGTCCTGATAT
CTTCACTTTCAGTTTTGCTCTCAAAGCATGTGAGAGGATCCGATTGATTCCGAAATGTTTGGAGCTTCACGGTTCGGTTA
TTCGATCTGGGTTTCTTGCTGATGCTATTGTTTCCACTAATCTCGTTCGTTGCTACTCTGCGAATGGAAGTGTTGAGATT
GCATCCAAAGTGTTCGACGAAATGCCTGTTAGAGACTTAGTTTCTTGGAACGCTATGATCTCCTGTTTTTCTCATGCTGG
TTTACATCATCAGGCGTTCAGTATGTACAGTCGAATGGCAAATGAAGGTGTGTGTGTTGACGCTTACACGATAGTTGCTT
TGTTATCTTCTTGTGCTCACGTTAGTGCTTTGAATATGGGAGTTATGCTACACAGGATCGCCTGTGATATTCGATGTGAG
AGTAGTGTCTTTGTGTGTAATGCTCTTATTGATATGTATGCAAAATGTGGTAGCCTTGAAAATGCTGTTGGTGTGTTTAA
AGGGATGCGCAAGAGAGATGTGTTGACCTGGAACTCAATGATTATTGGGTATGGAGTTCATGGGCACGGCGTAGAGGCCA
TCTCATTCTTCAGAAAGATGGTGGCTTCCGGGGTTAGACCCAATGCCGTCACATTCCTCGGATTGTTGTTAGGTTGTAGT
CATCAAGGTCTAGTTAAAGAAGGAGTTGAGCATTTTGAAATCATGAGTTCACAGTTCCATTTGACTCCGAACGTCAAACA
CTATGGATGCATGGTGGATCTCTTTGGACGAGCAGGTCAGCTAGAAAAGGCCCTTGAGATGATACACACGTCTTCCTGCC
ATGAAGATCCTGTCTTGTGGAGAACCCTGCTTGGCTCTTGCAAAATCCACAGGAATTTGGAATTAGGAGAAGTAGCCATG
AAGAAATTGGTGCAGCTTGAGGCTTTCAATGCAGGGGATTATGTGCTTATGACTTCGATATATTCTGCTGCAAATGATGC
ACAAGGTTTTGCTAGTATGAGAAAACTAATAAGAAGCCATGATTTACGGACTATTCCAGGCTGGAGTTGGATTGAGATCG
GTGATCAAGTTCACAAATTTGTCATTGATGACAAAATGCATCCGGAGTCTGCACTTATTTACTCAGAACTCGGGGAAGTA
ATCAACCGTGCCATTCTAGCTGGATACAAGCCAGAGGACTCGAACAGAACTGCTCATACTCTTTCTGATCGGTGTTTAGA
ATCTGCAGATACATCTCACAGTGAAAAATTGGCTATTGCATATGGATTAATGAGAACTACTGCAGGAACAACTCTCCGGA
TCACAAAGAATCTGAGAGTTTGCAGAGATTGTCATTCATTTACAAAATATGTATCAAAAGCATTCAATCGGGAAATTATT
GTAAGGGATAGAGTTCGATTTCATCAGTTTGCAGGCGAATTGATAGTTATTCGCGTGTTATACTCTCTTGGTGTTTTGTT
AAAATTATCACCACAAGACTCCTTAAAAGGAAAAGTGAGAGAGACAGGAGATGAGACAATCATTGACACAGAGGTCGTGA
TTATGGTCTGGAACAAGAATATAACAGAGACGCGAAAATCAACCAAAGAAAAAGAAGAATCCAAACCCCAGAAATTGCAG
AGACTTGAGAGCATTCTTTGGGATTGCAACACTTGA