Details for Lyrate rockcress Locus 16055326

Position : sca3 ( 5`- 22154588 .. 22158176 -3` )
Annotation : [B2G] polynucleotide adenylyltransferase family protein
External links : CoGe
PGDD synteny : 16055326

Protein [Map View]
MAGFIRRNGNVFFRSQTLSAFYSKLQRSNCTLAEGVMEKCSSIRSVIDEDINSVDTSKWKKVRASDAGIRNSMIPESSMN
VLRLLRRQGFDAYLVGGCVRDLILHRVPKDYDVITTANLKQIRRLFHRAQVIGKRFPICHVWMGGSIIEVSSFDTVAHSD
SEHEDDLEKSKEKSGVSLDTEANKNNSLFTMYSGWDVKDCNRWRNSLQRDFTINSLFYNPFELKIYDYANGMEDLTDLKL
RTLVPAHLSFKEDCARILRGLRIAARLGLSLSKDIETAIPEFVSSVANLDQFRLIMEMNYMLAYGAAAPSILLLMKFKLL
HVLLPFQAAYLDQASETSLSSSLMLVRLFSNMDKLVSCDQPADPKLWIAVLAFHIALVRNPQEAIVVRAFAALLYHRNWS
KAVKFAREHETSVVGYAPEVSKFSRKRSDEDLAEAVSEFTCLLKDTQYVLTDIEALREALYLYPDFKFSGLVFIPKRKGR
DVAEGLARLSDVESYESKKEGFSIDYLLLGKGNPCEVRFVLGKIILDTITEGIVIEPLNSVKKKQSTSNQIVSAACLEKK
DELFVTKSSKEENNNHTPVYDSNASSVLKILKRTRKESEQKIDQETEVCPRTLSGPAKNQDQSVVQKLKRRRSKEAQVSE
PPKQKTSKRSRSDDQEAVESISVPAKNQHQSNKHDTNAPICELPKQKTSKNRSKETQKVKHNDLPMKEIQEAKHGLVSDK
SMSDLLKVLEKSSQQVSSKEKSDSLSSQKTKRPRNLSSLFR*

DNA
ATGGCGGGTTTCATTAGGCGCAACGGAAACGTATTCTTTCGTTCTCAAACCCTATCCGCTTTCTACTCCAAGTTGCAGAG
AAGTAACTGCACGCTTGCTGAGGGAGTCATGGAGAAGTGTTCTAGCATTCGTTCAGTTATTGATGAAGATATAAATTCAG
TTGATACATCGAAGTGGAAGAAGGTACGAGCAAGTGATGCTGGAATTAGAAATTCAATGATCCCTGAATCCTCTATGAAT
GTCTTGAGACTCCTTAGACGTCAAGGTTTCGATGCATACCTTGTTGGTGGATGTGTAAGGGATTTGATACTGCATAGAGT
GCCAAAAGACTATGATGTGATCACTACAGCTAATCTTAAGCAGATCCGACGGCTGTTTCATCGTGCTCAGGTTATTGGGA
AACGGTTTCCTATTTGTCATGTGTGGATGGGAGGTTCGATAATTGAGGTGTCCAGTTTTGATACCGTGGCACACAGTGAC
AGTGAGCATGAAGATGATTTGGAGAAGTCTAAAGAGAAATCTGGTGTTTCACTGGATACCGAGGCAAACAAAAATAACAG
CCTCTTCACAATGTATTCTGGTTGGGATGTAAAAGACTGTAATCGTTGGAGGAATAGCTTGCAGCGGGATTTCACAATTA
ACAGTTTGTTCTATAATCCCTTTGAGTTAAAAATTTATGACTATGCCAATGGAATGGAAGACTTGACGGATCTTAAGCTT
CGTACACTTGTCCCTGCACATTTGTCATTCAAGGAAGATTGTGCTAGAATTCTTAGGGGGTTAAGAATTGCAGCACGATT
GGGTCTATCATTGTCAAAGGATATTGAGACTGCAATACCTGAATTTGTATCTTCCGTTGCAAATTTGGACCAGTTTAGAT
TAATCATGGAAATGAATTATATGCTTGCGTATGGAGCTGCTGCGCCTTCCATCCTTCTTCTCATGAAGTTCAAACTACTT
CACGTGTTACTTCCTTTTCAGGCAGCTTACCTGGATCAAGCTAGTGAAACATCTCTATCAAGTTCCTTGATGCTAGTGAG
ATTATTCTCCAATATGGATAAATTGGTTTCCTGCGATCAACCTGCTGACCCCAAACTATGGATTGCAGTGTTGGCCTTTC
ACATTGCACTAGTGCGTAACCCCCAGGAGGCTATTGTGGTGCGTGCTTTCGCCGCTTTGCTCTACCATAGAAACTGGAGC
AAAGCTGTCAAATTTGCTAGAGAACATGAAACTTCAGTAGTCGGATACGCTCCTGAGGTATCTAAATTTTCGAGAAAGAG
ATCTGATGAAGATCTTGCAGAAGCAGTTTCAGAATTCACATGTCTTTTAAAAGATACTCAATACGTTCTGACTGATATAG
AGGCTCTCCGCGAAGCCCTATACCTATACCCGGATTTCAAATTCTCTGGTCTGGTGTTTATACCGAAGAGAAAGGGGAGA
GATGTAGCAGAAGGGTTGGCGAGATTAAGTGATGTTGAATCATACGAAAGCAAAAAGGAGGGATTCTCTATTGATTATCT
CTTACTTGGGAAGGGAAATCCATGCGAAGTAAGATTTGTTCTTGGCAAAATCATTCTGGACACCATCACAGAAGGTATCG
TCATTGAACCTCTAAACTCTGTCAAGAAGAAGCAGAGCACCAGTAATCAAATTGTTTCAGCGGCTTGCTTGGAGAAGAAG
GATGAGTTGTTCGTTACTAAATCGTCAAAGGAGGAGAACAACAATCACACTCCAGTCTATGACTCAAATGCATCATCTGT
TCTGAAGATTTTGAAGAGGACGAGAAAAGAGAGTGAACAGAAGATCGACCAAGAGACCGAGGTATGTCCAAGAACCCTCT
CTGGTCCAGCAAAGAATCAAGATCAGTCTGTAGTTCAAAAGCTGAAAAGACGGCGTAGCAAAGAAGCACAAGTCTCAGAG
CCGCCTAAGCAAAAGACTTCAAAGAGGTCGAGATCAGATGACCAAGAGGCGGTTGAAAGTATCTCTGTTCCAGCAAAGAA
TCAGCATCAGAGTAACAAGCATGATACAAATGCACCGATCTGCGAGCTGCCTAAGCAAAAGACTTCAAAGAACCGTTCGA
AGGAGACACAAAAAGTGAAACACAACGACTTGCCTATGAAGGAGATTCAAGAAGCAAAACACGGCTTGGTGTCTGATAAA
TCTATGAGTGATCTTCTAAAAGTTCTTGAGAAATCAAGTCAGCAAGTGTCTAGCAAAGAGAAGAGCGACTCCTTATCATC
ACAGAAGACGAAGAGACCGAGAAATCTCTCAAGCCTCTTTAGGTGA