Details for Lyrate rockcress Locus 16055302

Position : sca1 ( 5`- 29085358 .. 29088679 -3` )
Annotation : [B2G] carbon-nitrogen hydrolase family protein
External links : CoGe
PGDD synteny : 16055302

Protein [Map View]
MRLLKVATCNLNQWAMEFESNMKNIKTSIAEAKAAGAVIRLGPELEVTGYGCEDHFLELDTVTHSWECLKELLVGDWTDG
ILCSIGMPVIKGAERYNCQVLCMNRRIIMIRPKMWLANDGNYRELRWFTAWKQREKLEDFQLPIEISEALDQKSLPFGYG
YIQFIDTAVAAEVCEELFSPLPPHAELALNGVEVFMNASGSHHQLRKLDIRLNAFMGATHARGGVYMYSNQQGCDGSRLY
YDGCACIVVNGDVVAQGSQFSLRDVEVIISQIDLDAVASLRGSISSFQEQASCKVKVSSVAVPCRLTQSFNLKMTLSSPK
KIIYHSPQEEIAFGPACWMWDYLRRSGASGFLLPLSGGADSSSVAAIVGCMCQLVVKEIAKGDEQVKADASRIGNYANGQ
FPTDSKEFAKRIFYTVFMGSENSSEETKRRAKQLADEIGAWHLDVCIDGVVSAVLSLFQTVTGKRPRYKVDGGSNAENLG
LQNIQARMRMVLAFMLASLLPWVHSKPGFYLVLGSSNVDEGLRGYLTKYDCSSADINPIGSISKMDLRLFLKWAATNLGY
PSLAEIEAAPPTAELEPIRSDYSQLDEVDMGMTYEELSVYGRMRKIFRCGPVSMFKNLCYKWGTKLSPAEVAEKVKYFFK
YYSINRHKMTVLTPSYHAESYSPEDNRFDLRQFLYNSKWPYQFKKIDEIVDGLNGDSVAFPEEEANSNREIGVVAANSED
PSAGL*

DNA
ATGAGGCTGTTGAAGGTCGCTACGTGTAACTTGAACCAATGGGCCATGGAATTCGAGAGCAACATGAAGAATATCAAGAC
TTCCATCGCTGAGGCAAAAGCCGCCGGTGCTGTCATCAGGCTTGGACCTGAGCTCGAGGTCACTGGCTATGGCTGCGAGG
ATCACTTCTTGGAGCTCGACACCGTCACTCATTCGTGGGAGTGTTTGAAGGAATTGCTGGTTGGTGATTGGACGGATGGA
ATATTATGCAGCATAGGAATGCCTGTTATTAAAGGAGCAGAGCGGTATAATTGTCAGGTTCTCTGTATGAACAGAAGAAT
CATCATGATTCGACCGAAAATGTGGCTTGCAAACGATGGAAACTATAGGGAGCTACGGTGGTTCACGGCTTGGAAGCAGA
GAGAAAAGCTAGAGGACTTTCAGCTCCCAATTGAAATTTCAGAGGCTTTGGATCAGAAATCACTCCCTTTTGGTTATGGT
TACATCCAGTTTATCGACACGGCTGTTGCAGCTGAAGTCTGTGAGGAACTTTTTAGTCCACTTCCTCCTCATGCCGAGCT
CGCATTGAATGGGGTTGAAGTATTTATGAATGCAAGTGGGAGTCATCACCAACTTAGGAAACTAGATATTCGTCTGAATG
CTTTCATGGGGGCTACTCATGCTCGTGGTGGGGTGTATATGTACAGTAATCAACAGGGATGTGATGGTAGCCGCTTATAT
TACGATGGATGTGCATGCATTGTTGTAAACGGTGATGTTGTCGCTCAAGGCTCACAATTCTCATTGAGGGACGTTGAGGT
CATCATTTCCCAAATAGATCTTGATGCGGTTGCTAGTCTTCGTGGATCTATAAGTAGCTTTCAGGAACAAGCAAGCTGCA
AGGTTAAAGTGTCTTCAGTAGCCGTACCATGTAGGCTGACACAGTCCTTTAACCTGAAAATGACACTAAGCAGTCCGAAG
AAGATCATTTACCACTCTCCACAAGAAGAAATAGCCTTTGGTCCCGCTTGCTGGATGTGGGACTATTTGAGAAGAAGTGG
TGCTTCAGGATTTCTGCTTCCTCTTTCTGGCGGAGCAGACAGCTCCTCCGTGGCAGCTATTGTTGGCTGCATGTGCCAAC
TTGTTGTTAAAGAGATTGCAAAGGGAGATGAGCAAGTAAAAGCTGATGCGAGCCGAATTGGGAATTATGCTAATGGACAG
TTTCCTACTGATAGCAAAGAGTTTGCCAAACGAATATTTTACACTGTCTTTATGGGTTCTGAAAACAGTTCTGAGGAGAC
AAAAAGGCGTGCAAAGCAGCTGGCAGATGAGATCGGTGCTTGGCATCTTGATGTTTGCATAGATGGTGTTGTCTCTGCGG
TTCTATCTTTATTTCAAACGGTTACAGGGAAGCGACCTCGGTATAAGGTTGATGGAGGATCAAACGCTGAGAACCTTGGG
TTGCAGAACATTCAAGCCCGGATGAGAATGGTTTTAGCATTTATGTTAGCGTCTCTCTTGCCTTGGGTTCATAGCAAACC
AGGCTTTTACCTTGTTCTAGGCAGCTCCAACGTCGATGAAGGGCTTCGTGGTTACCTGACAAAGTATGATTGCAGCTCAG
CAGACATAAATCCCATAGGAAGTATCAGTAAAATGGATTTGAGGTTGTTCTTAAAATGGGCTGCAACGAATCTCGGATAT
CCATCCTTGGCAGAGATAGAAGCTGCTCCACCAACAGCTGAGCTTGAGCCCATTCGTTCTGACTATTCTCAGCTTGATGA
AGTCGACATGGGAATGACATATGAAGAGCTTTCAGTCTATGGAAGGATGAGGAAGATATTCCGTTGTGGACCAGTTTCTA
TGTTCAAGAATCTATGTTACAAGTGGGGAACAAAGCTAAGCCCAGCAGAAGTAGCTGAGAAAGTGAAGTATTTCTTCAAA
TATTATTCGATCAATCGACACAAAATGACTGTCCTCACACCGTCTTATCACGCTGAGAGTTACTCTCCAGAGGACAACAG
ATTCGATCTGAGGCAGTTTCTGTACAACAGCAAGTGGCCATACCAGTTTAAGAAGATTGACGAGATTGTTGACGGCTTAA
ATGGCGACTCAGTTGCTTTCCCGGAAGAAGAAGCAAACTCCAACAGAGAAATTGGAGTTGTAGCAGCAAACTCTGAAGAC
CCAAGCGCGGGTCTCTGA