Details for Lyrate rockcress Locus 16055259

Position : sca3 ( 5`- 8001032 .. 7999944 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479371 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16055259

Protein [Map View]
MASSSSSSLSSSSSKKKKNLFKKPNSASSSSRATSLIKRQATVFKKAEELSILCDIDVCVICYMSDGKLKTWPDDREKVK
AIARRYGELSETKRRKGSVDLHEFLERINKDDSKEEEEKKKKIKVRRVSRVKYPVWDPRFDNYSVEQLTGLVQSLERNLT
RIQHRTHAVGEAQGQRRMQYTNMASQELMMAHTMNQLQQHSNQVSMYLWNHDNGSFSQIPVSALASNQAQSLAPIPSELM
IYPNSDVGSYSGSLGVQGTGINGLQTMNMLTYNNINSVNDFAKQIDQNSRVESYSSLLGVHEYGNNEFENTNMSSRNNFN
VQDYAGLLGVEGTVTGTNGLQSMNMHDYNNNNNSNANGLSHQL

DNA
ATGGCTTCTTCTTCGTCCTCTTCTCTTTCGTCTTCATCATCGAAGAAGAAAAAAAACCTTTTCAAGAAACCTAATTCTGC
TTCTTCTTCTTCGAGAGCCACAAGCTTAATTAAAAGACAAGCGACTGTCTTTAAGAAAGCTGAAGAGCTTTCAATTCTCT
GTGACATCGATGTCTGCGTCATCTGTTACATGTCAGACGGAAAGCTCAAGACATGGCCTGACGACAGAGAGAAGGTCAAA
GCCATAGCTCGAAGGTACGGTGAATTAAGCGAGACGAAGCGTCGCAAAGGAAGCGTTGATCTTCACGAGTTCCTCGAGAG
GATCAATAAGGATGATTCCAAGGAGGAGGAGGAGAAGAAGAAGAAGATTAAAGTGAGACGTGTATCCAGAGTCAAGTATC
CAGTTTGGGACCCTAGGTTTGATAATTACTCTGTGGAGCAACTCACTGGGCTTGTTCAGTCCTTGGAGCGAAACCTAACC
AGAATCCAACATAGGACTCACGCTGTTGGTGAAGCTCAGGGACAGAGGAGGATGCAGTACACGAACATGGCTAGTCAAGA
ACTGATGATGGCTCATACGATGAACCAACTTCAACAACATTCAAACCAGGTTTCCATGTATCTGTGGAACCATGATAACG
GTTCTTTCTCGCAAATCCCAGTCTCTGCATTAGCTTCAAACCAAGCGCAATCTCTGGCTCCGATTCCGTCTGAACTAATG
ATTTACCCAAATTCGGATGTGGGAAGTTACTCGGGGTCACTTGGGGTACAAGGAACTGGGATCAACGGGCTTCAGACCAT
GAACATGTTAACCTACAACAACATCAACAGCGTTAATGATTTCGCAAAACAGATTGACCAAAATTCCAGAGTGGAAAGTT
ACTCTAGCTTACTTGGGGTACACGAATACGGAAACAATGAGTTTGAGAACACTAACATGTCCAGCCGCAACAACTTCAAT
GTTCAAGACTATGCAGGGTTACTTGGGGTGGAAGGAACTGTAACTGGAACTAACGGGTTGCAGAGCATGAACATGCACGA
CTACAACAACAACAACAACAGTAACGCTAATGGTCTTTCGCATCAGCTT