Details for Lyrate rockcress Locus 16055254

Position : sca3 ( 5`- 7348604 .. 7345475 -3` )
Annotation : [B2G] invertase pectin methylesterase inhibitor family protein
External links : CoGe
PGDD synteny : 16055254

Protein [Map View]
MAYPCVKRNVFSLLPLLVLLSVTPLSSSLSPSDKITKDLLYYLCTEPNIDSSFCIPWLTSDPTTFTLDLQGLLDLVFQKT
QLLGYKSLAAMKGSVRTMPGSTLKIPFETCVKDYESAIKSIEEAQGFLTSKAYALASQGAAKAFISISVCEAQFEGRADV
PAYGAKKMAYPCVKRNVFSLLPLLVLLSVTPLSSSLSPSDKVTKGLLYQLCTKPNIDSYFCIPWLNSDPTTFTLDLQGLL
DLVFQKTQLLGYKSLAAMKGSVRTTTDPTLKIPFETCVKDYEVAIKAIEEAQGFVTSKAYPLASQGAAKAFISISVCEAQ
FEGRVNVPDYVAKLNSFFKRMCNIDRVFSDVLTS*

DNA
ATGGCTTATCCTTGCGTCAAAAGAAACGTATTTTCACTTCTTCCTCTACTCGTTCTTCTATCAGTCACCCCTTTGTCTTC
ATCTTTGTCTCCGAGTGACAAAATCACAAAAGACTTACTTTACTACCTCTGCACAGAACCAAACATTGACAGCAGCTTCT
GCATCCCTTGGCTAACCTCTGATCCAACAACATTCACTCTCGACCTACAAGGTCTTCTCGATTTGGTCTTCCAAAAGACG
CAATTGTTGGGCTATAAGAGCCTAGCGGCGATGAAAGGCTCAGTGAGAACCATGCCTGGTTCGACGCTCAAGATCCCATT
TGAGACTTGCGTGAAAGATTATGAATCAGCCATTAAATCGATCGAGGAAGCTCAAGGGTTTCTGACCTCTAAGGCGTACG
CGTTAGCATCTCAAGGGGCTGCTAAAGCCTTCATTAGTATATCAGTGTGTGAAGCTCAGTTTGAAGGACGGGCTGATGTG
CCGGCTTATGGTGCCAAGAAAATGGCTTATCCTTGCGTCAAAAGAAACGTATTTTCACTTCTTCCTCTACTCGTTCTTCT
ATCAGTCACCCCTTTGTCTTCATCTTTGTCTCCGAGTGACAAAGTCACAAAAGGATTACTTTACCAACTCTGCACAAAAC
CGAACATTGACAGCTACTTCTGCATCCCTTGGCTAAACTCTGATCCAACAACATTCACCCTCGACCTACAAGGTCTTCTC
GATTTGGTCTTCCAAAAGACGCAATTGTTGGGCTATAAGAGCCTAGCGGCGATGAAAGGCTCAGTGAGAACCACGACTGA
TCCGACGCTCAAGATCCCATTTGAGACTTGCGTGAAAGATTATGAAGTAGCCATTAAAGCGATCGAGGAAGCTCAAGGGT
TTGTGACCTCTAAGGCGTACCCGTTAGCATCTCAAGGGGCTGCTAAAGCCTTCATTAGTATATCAGTGTGTGAAGCTCAG
TTTGAAGGACGGGTTAATGTGCCGGATTATGTAGCGAAACTCAATTCATTTTTTAAAAGAATGTGTAACATTGATAGGGT
TTTCTCCGACGTTTTGACTTCTTGA