Details for Lyrate rockcress Locus 16055238

Position : sca3 ( 5`- 1188069 .. 1193604 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_896385 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16055238

Protein [Map View]
MLTSPSNALHSSTPHFWPVRRSRLCRSRNFPRFHSGERSSGGGGKLCPLSLLSASGASKFSVRALVRPDVTEDADSVGDG
SLAFPNHVSVKIPFGNREILVETGLMGRQASSAVTVTDGETIVYTSVCLADVPSEPSDFLPLYVHYQERFSAVGRTSGGF
FKREGRTKDHEVLICRLIDRPLRPTMPKGFYNETQILSWVLSYDGLHAPDALAVTSAGIAVALSEVPNAKAIAGVRVGLI
GGEFIVNPTVKEMEESQLDLFLAGTDTAILTIEGYSNFLPEEMLLEAVKVGQDAVQATCIAIEVLAKKYGKPKMLDAIRL
PPPELYKHVKELAGEELTKALQIKSKISRRKAISSLEEKVLTILTEKGYVIDEVAFGTIEAQPDLLEDEDEDEEVVPEGE
VDQGDVHIRPIPRKPIPLLFSEVDVKLVFKEVSSKLLRRRIVEGGKRSDGRTLDEIRPINSRCGLLPRAHGSTLFTRGET
QALAVVTLGDKQMAQRIDNLEGSDEYKRFYLQYTFPPSSVGEVGRIGAPSRREIGHGTLAERALETILPSDDDFPYTIRV
ESTVIESNGSSSMASVCGGCLALQDAGVPVKCSVAGIAMGMVWDTEEFGGDGSPLILSDITGAEDASGDMDFKVAGNEDG
VTAFQMDIKVGGITLEIMEKALIQAKAGRRHILAEMAKCSPPPTLSLSKYAPLIHIMKVHPSKVYSLIGSGGKKVKSIIE
ESGVEAIDMQDDGTVKIMAIDVASLERAKAIISGLTMVPAVGDIYRNCEIKSMAPYGAFVEIAPGREGLCHISELSAEWL
AKPEDAYKVGDRIDVKLIEVNEKGQLRLSVRALLPESETDKDSQKQQPAGDSTKDKGSQRKYVNTSSKDRAAAGASKVSS
GDELVLKKKDVRRATGGSSDKTMKSNSSTNEESLVNGEATIS*

DNA
ATGCTGACGAGTCCCAGTAACGCACTTCACAGTAGTACTCCACACTTCTGGCCAGTTCGCCGGAGCAGGCTTTGCCGTTC
CCGGAATTTCCCTCGTTTTCACTCCGGCGAACGCAGCAGCGGCGGAGGAGGAAAATTGTGCCCGCTCTCTCTTCTCTCCG
CAAGTGGCGCCAGTAAATTCAGTGTCAGGGCTCTAGTTAGACCAGATGTTACCGAAGACGCTGACTCCGTCGGCGATGGG
TCACTGGCTTTTCCTAACCACGTTTCTGTCAAAATTCCTTTCGGAAATAGAGAGATTTTAGTAGAGACTGGTCTTATGGG
GAGACAAGCAAGCTCTGCTGTAACAGTGACAGATGGAGAAACTATTGTCTACACATCTGTTTGTCTAGCTGATGTTCCAA
GTGAGCCATCAGATTTTCTTCCGCTTTATGTTCACTATCAGGAGCGATTCTCAGCTGTAGGTCGAACTAGTGGTGGATTT
TTTAAGCGAGAAGGAAGAACCAAAGATCACGAGGTTCTGATTTGTAGGTTGATCGATAGACCTCTACGCCCCACTATGCC
CAAAGGTTTCTACAATGAAACTCAGATATTATCCTGGGTTTTGAGCTATGATGGATTACACGCACCTGATGCTTTAGCTG
TTACATCTGCTGGAATTGCTGTAGCTCTTTCAGAAGTACCAAATGCGAAAGCGATTGCAGGAGTTCGGGTTGGTCTAATT
GGGGGCGAATTCATCGTCAATCCAACCGTGAAGGAGATGGAAGAGTCACAGCTAGATTTGTTTCTAGCTGGAACAGATAC
AGCAATATTAACGATAGAGGGATACAGTAATTTTCTTCCTGAGGAAATGCTGCTCGAAGCTGTTAAAGTTGGACAGGATG
CTGTACAGGCTACATGCATCGCTATTGAAGTTTTAGCAAAGAAATATGGAAAGCCCAAAATGCTTGACGCTATCAGATTA
CCACCTCCAGAGCTATACAAGCATGTGAAAGAACTTGCTGGTGAGGAATTGACCAAAGCGCTACAAATTAAGAGCAAAAT
ATCGAGAAGGAAAGCCATATCGTCCCTGGAAGAAAAGGTCTTGACAATACTGACAGAGAAGGGGTATGTTATTGATGAGG
TTGCATTTGGAACCATAGAAGCACAACCTGATCTGTTGGAGGATGAAGACGAGGATGAGGAAGTTGTTCCTGAAGGGGAG
GTGGACCAAGGCGATGTACACATTAGGCCCATCCCTCGGAAACCTATTCCTTTACTATTTTCTGAAGTAGATGTCAAGCT
GGTCTTCAAAGAAGTATCGTCAAAGCTCCTACGGAGGCGAATTGTTGAGGGAGGTAAAAGAAGTGATGGTCGGACTCTGG
ATGAGATTCGTCCAATTAACTCAAGATGTGGACTGCTTCCAAGGGCACATGGAAGTACTCTTTTCACACGTGGTGAAACA
CAGGCACTGGCAGTTGTTACACTTGGTGATAAACAAATGGCGCAGAGAATTGACAACCTTGAGGGTTCTGATGAATACAA
GAGGTTCTATCTTCAGTACACGTTTCCTCCATCGTCTGTTGGTGAAGTTGGACGAATTGGTGCACCCAGTCGAAGAGAAA
TAGGTCATGGCACACTAGCAGAGCGAGCATTGGAGACCATTCTACCTAGTGATGATGACTTTCCTTACACAATACGCGTT
GAAAGTACAGTAATTGAAAGCAATGGTTCTTCAAGTATGGCATCTGTTTGCGGCGGTTGCTTGGCTTTGCAAGATGCCGG
AGTTCCAGTTAAATGTTCTGTTGCTGGGATAGCAATGGGAATGGTTTGGGATACTGAAGAATTTGGCGGTGATGGATCTC
CCCTTATCCTTTCTGATATCACTGGAGCTGAAGATGCATCTGGTGATATGGACTTTAAGGTTGCTGGGAATGAAGATGGT
GTTACCGCCTTTCAGATGGACATTAAGGTAGGAGGAATCACTTTAGAGATAATGGAAAAGGCTCTGATACAGGCAAAAGC
TGGGCGTCGCCATATTCTTGCTGAAATGGCAAAGTGCTCACCGCCTCCTACATTAAGCCTCTCAAAATACGCTCCATTGA
TACATATTATGAAGGTTCATCCAAGCAAAGTATACTCTCTTATTGGTTCTGGTGGTAAGAAAGTAAAGAGCATCATTGAA
GAATCTGGAGTTGAGGCCATTGATATGCAAGATGATGGAACTGTCAAAATTATGGCAATCGATGTAGCGAGTCTGGAAAG
GGCGAAAGCGATTATTAGTGGATTGACAATGGTTCCCGCTGTTGGTGATATCTACAGGAATTGTGAAATCAAGTCAATGG
CTCCTTATGGTGCCTTTGTAGAGATTGCACCTGGGCGGGAAGGTCTTTGCCATATCAGTGAGCTGAGTGCTGAATGGCTT
GCAAAACCAGAGGATGCCTATAAAGTAGGAGACCGCATTGACGTCAAACTAATAGAGGTGAATGAAAAGGGTCAGCTTCG
ACTTAGTGTACGGGCTTTACTTCCCGAATCAGAGACAGACAAAGACAGTCAGAAACAACAGCCGGCAGGTGATTCTACCA
AAGACAAGGGTTCGCAAAGGAAATATGTAAATACTTCGTCAAAGGACCGTGCAGCAGCAGGAGCATCAAAGGTTTCATCT
GGGGATGAACTTGTCCTGAAGAAGAAAGATGTAAGGAGAGCAACTGGTGGTAGTAGTGACAAGACAATGAAAAGCAATAG
CAGTACCAACGAAGAAAGTTTAGTCAACGGTGAAGCTACAATCAGCTAG