Details for Lyrate rockcress Locus 16055208

Position : sca3 ( 5`- 1136892 .. 1134561 -3` )
Annotation : [B2G] mate efflux family protein
External links : CoGe
PGDD synteny : 16055208

Protein [Map View]
MSTQGEMEERLLRVGSNAEGQSNHRESIYLRTKVWSEVSKMWRIALPSSLFRMTSFGSIIVAQAFIGHSSELGLAAYALL
QSTFIRFLYGLMGGMSSATETLCGQAYGAEQYHTMGIYLQRSWIVDMVVTSLFLPFIVLAGPILRLLGQNVEITKTVDEI
YLWMIPYVYSLIFTMTIQMYLQAQMRNAIVGVLSTLSLALDLVVTWWCVSVMGMGIGGALLGLNVGSWAMVLAEFVYIFG
GWCPFTWTGFSIAAFVDLIPMLKLSISSGFMICLEYWYMSILVLMAGYTKDAKIAISAFSICQYIYTWELNICLGFLGAA
CVRVANELGKGDADAVRFSIKVILTVSTFMGVMFSALCLAFCGQISYLFSNSVEVSEAVDDLSVILAISILLNSIQPILS
GVAVGAGMQSIVAVVNLASYYAIGIPLGLILTLVFHLGVKGLWSGMLAGIAIQTMILCYIIYKTDWELEVKRTSERMKVW
SLKPFNEESNPIIREESESK*

DNA
ATGAGTACTCAAGGAGAAATGGAGGAGAGGCTGTTACGTGTAGGCTCAAATGCTGAGGGTCAGAGCAATCATAGGGAGAG
TATCTATTTGAGAACCAAGGTTTGGAGTGAAGTAAGTAAAATGTGGAGAATAGCATTACCTTCGTCTTTGTTCCGAATGA
CTTCGTTTGGGAGCATCATTGTGGCTCAAGCCTTCATCGGTCACTCCTCTGAGTTGGGTCTAGCCGCTTACGCGCTCCTC
CAAAGCACATTCATCCGCTTCCTCTATGGTTTAATGGGCGGTATGTCAAGTGCAACGGAGACATTATGCGGGCAAGCATA
CGGTGCAGAACAATACCACACAATGGGGATATATCTACAACGTTCATGGATCGTGGACATGGTCGTGACCTCTCTGTTCC
TACCGTTTATTGTACTTGCGGGTCCCATTCTCCGCCTATTAGGCCAAAACGTTGAGATCACAAAGACCGTTGATGAGATA
TATCTGTGGATGATTCCTTATGTCTATAGCTTAATTTTCACTATGACCATACAAATGTATCTCCAAGCACAGATGAGGAA
CGCCATTGTAGGCGTTCTTTCGACATTGTCCTTGGCTCTCGACCTCGTGGTCACGTGGTGGTGCGTGAGTGTTATGGGAA
TGGGCATTGGTGGTGCGCTCCTCGGACTTAATGTGGGCTCGTGGGCAATGGTATTAGCCGAGTTTGTGTACATTTTTGGT
GGATGGTGTCCGTTTACTTGGACCGGATTTAGTATTGCTGCTTTTGTTGACCTAATTCCTATGCTCAAGCTCTCCATTTC
TTCAGGCTTCATGATCTGCTTAGAGTATTGGTACATGAGCATCCTTGTCTTAATGGCTGGGTATACAAAAGATGCGAAAA
TTGCAATCTCTGCTTTCTCGATATGCCAATACATATATACATGGGAACTCAACATATGCCTTGGCTTCTTGGGTGCGGCT
TGTGTCCGGGTGGCTAACGAGCTGGGGAAAGGAGATGCAGATGCAGTGAGGTTTTCAATAAAAGTGATACTCACAGTATC
AACATTTATGGGAGTGATGTTCTCAGCTCTATGCTTAGCTTTCTGTGGTCAGATTTCGTATTTGTTTTCGAATAGCGTTG
AGGTTTCAGAGGCAGTGGATGATTTGTCGGTAATCCTTGCCATTTCAATCTTACTCAACAGCATACAACCTATACTCTCA
GGTGTAGCAGTTGGAGCAGGGATGCAGAGTATAGTGGCAGTTGTGAACTTAGCCTCTTATTATGCAATTGGCATTCCTTT
GGGTCTCATCCTTACTCTTGTTTTCCATCTTGGTGTTAAGGGACTATGGTCTGGAATGTTGGCCGGAATTGCTATCCAAA
CAATGATATTGTGTTATATCATTTACAAAACTGACTGGGAATTAGAGGTTAAAAGGACAAGTGAACGTATGAAAGTGTGG
AGCCTGAAGCCATTTAATGAAGAGTCGAATCCCATAATAAGAGAAGAAAGTGAGAGCAAGTGA