Details for Lyrate rockcress Locus 16055205

Position : sca3 ( 5`- 11159338 .. 11160729 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479896 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16055205

Protein [Map View]
MGRVQEEGSGPVHGFRLSTVSASQPSETDTTHEPTGLDLAMKLHYLKAVYIYSAETARDLTVMHVKTPLFSVFDQIPCII
GRFRRHDSGRPYIKCNDCGTRFVESHCDLTVEEWLHVPDRSVDEALVYHQPVGPELAFSPLLYIQMTRFSCGGLALGLSW
AHAMGDPFSLSHFFNLWAQAFAGEKIYSPKTSDTERVCQNPNSTVKKPNSIKRVDPVGDLWVAPNNSKMTTFSFNLTVND
LKSHFPANGDDEFKILAGIIWKCVATARGESAPVTITVIRLDPKELKPRAVRNGQMISSVHVDFSVAEASLEEIVKAIGE
ARDERFGIDDIVDDVSDFIVYGANLTFVDMSEVDFYEAKVMGKSPESVYCNVQGIGDDGAVVVLPGVVEEERVVTVTLPE
DEIEKVKWEMKKCGLITPLV*

DNA
ATGGGTCGAGTTCAAGAAGAGGGAAGCGGTCCGGTTCATGGCTTCCGCTTATCGACTGTGAGTGCGTCTCAACCCTCAGA
GACCGATACGACCCACGAACCCACCGGTTTAGACCTCGCCATGAAGCTTCACTACCTTAAGGCGGTTTACATTTACTCGG
CCGAGACAGCACGTGACTTGACCGTGATGCACGTGAAGACGCCTTTGTTTTCAGTGTTCGACCAGATCCCATGTATCATT
GGCAGGTTCAGGCGACACGATTCGGGACGTCCGTACATAAAGTGTAACGACTGTGGCACACGTTTCGTGGAAAGTCATTG
TGATCTCACTGTGGAGGAGTGGCTCCATGTACCGGACCGGTCCGTTGATGAGGCTCTGGTTTACCATCAACCAGTTGGAC
CGGAATTAGCATTCTCTCCTTTGCTCTATATTCAGATGACCCGGTTTAGCTGCGGTGGATTAGCTTTGGGCTTAAGCTGG
GCTCATGCCATGGGAGATCCATTCTCTCTTTCTCATTTCTTCAACTTATGGGCTCAAGCCTTTGCTGGTGAGAAGATCTA
CTCCCCCAAAACCTCTGATACAGAAAGAGTCTGTCAAAACCCGAACTCAACGGTCAAAAAACCCAATTCAATCAAACGGG
TTGACCCGGTTGGAGATCTCTGGGTCGCTCCGAATAACAGCAAAATGACAACATTCTCCTTCAATTTAACGGTTAACGAT
CTCAAATCACATTTTCCGGCGAACGGAGACGACGAATTCAAGATTCTCGCTGGAATTATATGGAAATGTGTTGCGACGGC
GAGGGGAGAATCAGCTCCGGTGACGATTACGGTTATCAGATTGGATCCGAAGGAGTTGAAGCCTAGAGCGGTGAGAAATG
GTCAGATGATAAGTTCCGTTCACGTCGATTTCTCGGTGGCGGAGGCGAGTCTGGAGGAGATTGTGAAAGCAATCGGTGAA
GCGAGAGATGAGAGGTTTGGGATCGATGATATTGTTGATGATGTTTCGGATTTTATTGTTTACGGAGCGAATTTGACGTT
TGTGGATATGAGTGAAGTTGATTTTTATGAGGCGAAAGTTATGGGAAAGTCACCGGAATCGGTTTATTGTAATGTTCAGG
GGATTGGTGACGACGGAGCTGTGGTGGTTTTACCGGGGGTTGTGGAGGAGGAGAGAGTTGTGACGGTGACGTTACCGGAG
GATGAGATTGAGAAGGTGAAATGGGAAATGAAGAAGTGTGGTTTGATCACGCCGTTAGTTTAA