Details for Lyrate rockcress Locus 16055202

Position : sca3 ( 5`- 10286532 .. 10287056 -3` )
Annotation : [B2G] rna polymerase rpb7 n-terminal domain-containing protein
External links : CoGe
PGDD synteny : 16055202

Protein [Map View]
MFIKVKLPWDVTIPAEDMDTGLMLQRAIVIRLLEAFGTKKATKDLGYLITPTILENIGEGKIKEQTGEIQFPVVFNGICF
KMFKGEVVHGVVQKVHKSGVFLRSGPYEIIYLSHVKMPGYEFIPGEKPIFMNQNMSRIQIGARVRFIVLDTEWREAEKDF
MALASIDGDNLGPF*

DNA
ATGTTCATCAAAGTCAAATTGCCATGGGATGTTACAATTCCAGCTGAAGATATGGACACTGGCCTTATGCTCCAGAGAGC
TATTGTCATTCGCCTACTCGAAGCCTTTGGTACCAAGAAAGCAACAAAAGATCTTGGATACTTGATAACACCCACAATTC
TTGAGAACATCGGTGAGGGTAAGATCAAGGAACAGACAGGCGAAATTCAATTTCCCGTAGTTTTCAACGGAATCTGTTTC
AAGATGTTTAAAGGAGAGGTTGTTCATGGTGTGGTGCAAAAGGTGCACAAGAGCGGAGTCTTTTTGAGATCTGGCCCTTA
TGAAATCATTTACCTATCACACGTGAAAATGCCCGGTTACGAGTTCATTCCAGGAGAGAAACCGATTTTTATGAATCAGA
ACATGTCCCGGATTCAAATCGGCGCCAGAGTTCGTTTCATCGTGTTAGATACCGAGTGGAGAGAGGCAGAGAAAGACTTC
ATGGCTTTGGCCAGCATCGACGGAGACAATCTTGGCCCGTTCTAA