Details for Lyrate rockcress Locus 16055183

Position : sca3 ( 5`- 8275683 .. 8275172 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16055183

Protein [Map View]
MANAVEQSSLYPSFVDARISFSNDFADSDSKQTVSRVEDQMKYKEAPVSSDFKFNVENLGFTSAADEIFFGGVLLPLEKT
TQRKVTTLRDELSAQDSDRTIISKGSRNWWKLGLNKSKKIHAHKSQNCLASIMESDD*

DNA
ATGGCTAATGCTGTAGAACAATCCTCATTGTATCCATCCTTTGTAGACGCAAGAATCTCATTCTCCAATGATTTTGCAGA
CAGTGACAGTAAACAGACAGTGTCAAGAGTGGAGGATCAGATGAAGTACAAGGAAGCTCCTGTTTCTTCGGATTTCAAAT
TCAATGTCGAAAACTTGGGTTTCACTTCTGCGGCTGATGAGATCTTCTTTGGTGGAGTTTTGTTGCCACTGGAGAAGACT
ACTCAGAGGAAAGTGACGACACTTAGAGATGAACTAAGTGCTCAAGATTCTGACCGTACCATCATCTCAAAGGGATCTCG
TAATTGGTGGAAGTTAGGTCTCAACAAGTCCAAGAAAATCCATGCACACAAATCTCAGAATTGTCTTGCAAGTATAATGG
AATCTGATGACTGA