Details for Lyrate rockcress Locus 16055178

Position : sca3 ( 5`- 2468860 .. 2470237 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_340799 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16055178

Protein [Map View]
MTDTQIPDNSSSSSNQSPTKPESLRSLEFQLGSSFTADPIIPPPNQIVIVISGPSGVGKDAVINKLREVREGLHFVVTAT
SRPMRPGEVDGKDYFFVSRDQFLSMVENEELLEYALVYGEYKGIPKKQIQEFMAKGEDIVLRVDIQGAQTLRRILGNSAV
FIFLVAESELAMVERLIDRKTESQEELLVRVATAREEVRHLKNFDYVVVNAKGRLDDAVNRVESIIDAEKSKEDLVQLIC
LGSFLQKFLGLAMSFRNYGLGIPNANIACCLQSRFHREPRQFWYLYKGNEHSGDSSLLQGILLNQS*

DNA
ATGACCGATACCCAGATCCCTGATAACTCTAGTTCGTCCTCAAATCAATCTCCCACCAAACCCGAATCGCTTCGTTCCCT
CGAATTTCAATTGGGTTCTTCTTTCACCGCCGATCCAATTATCCCACCGCCGAATCAGATCGTCATCGTTATCAGTGGTC
CGAGCGGAGTTGGCAAAGACGCAGTGATCAACAAGCTTCGTGAGGTTCGTGAAGGTCTACATTTCGTTGTTACCGCCACT
AGCCGTCCGATGCGACCTGGTGAAGTTGATGGTAAAGACTATTTCTTTGTCTCGAGAGATCAATTCTTATCAATGGTGGA
GAACGAAGAGCTTCTTGAATACGCACTTGTTTATGGAGAGTACAAAGGGATTCCAAAGAAGCAGATTCAGGAGTTTATGG
CTAAAGGGGAAGACATTGTTCTTAGAGTTGATATTCAAGGAGCTCAGACGTTAAGGAGGATACTTGGTAACTCTGCCGTG
TTTATATTCCTTGTGGCGGAGAGTGAGCTTGCGATGGTGGAGAGGTTGATTGATCGGAAGACGGAGAGTCAAGAGGAGCT
GCTTGTTAGAGTTGCTACGGCGAGGGAAGAGGTTAGGCATCTAAAGAACTTTGATTACGTTGTGGTGAATGCAAAAGGGA
GGCTTGATGATGCGGTTAATCGCGTGGAATCCATTATCGATGCTGAGAAATCCAAAGAAGATCTTGTGCAGCTGATTTGT
TTAGGGAGCTTCTTGCAAAAGTTCTTAGGTTTGGCAATGTCATTTAGGAACTATGGTTTGGGTATACCGAATGCAAATAT
TGCTTGCTGTCTCCAGTCACGGTTTCATCGCGAACCAAGACAATTTTGGTATCTGTACAAGGGAAATGAACATTCAGGTG
ATTCCTCCCTGTTACAAGGAATCCTTTTGAATCAAAGTTAG