Details for Lyrate rockcress Locus 16055167

Position : sca3 ( 5`- 8593934 .. 8590214 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16055167

Protein [Map View]
MILQSSSCSTFDFPSFVPRRLLCPCSNEHALIVFCDGFAKRRRILRRVQAANANSRFVSSGSRTDSMNIGLARRAARSLV
VTRFSNEFEDEEESSSSQESAIQGDRNSFTNFREDPIVDKLRTHLGVIHPIPSPPISRNAIGLFAFFFFVGVICDKLWTW
RKRRRQTSGDEGGQRGARPWAQVPTSFSLSLEKDLQRKESVEWVNMVLVKLWKVYRGGIENWLVGLLQPVIDDLKKPDYV
QRVEIKQFSLGDEPLSVRNVERRTSRRVNDLQYQIGLRYTGGARMLLMLSLKFGIIPVVVPVGIRDFDIDGELWVKLRLI
PSAPWVGAASWAFVSLPKIKFELAPFRLFNLMGIPVLSMFLTKLLTEDLPRLFVRPKKIVLDFQKGKAVGPVSEDLKSGE
MQEGNKDFVGELSVTLVNAQKLPYMFSGRTDPYVILRIGDQVIRSKKNSQTTVFGAPGQPIWNQDFQFLVSNPREQVLQI
EVNDCLGFADMAIGIGEVDLESLPDTVPTDRFVSLQGGWSLFGKGSTGEILLRLTYKAYVEDEEDDKRNAKAIYADASDD
EMSDSEEPSSFVQNDKIPSDDIGQESFMNVLSALILSEEFQGIVSSEAGNNKVDDRESSVSPVPSKAGADSKSRPKDAGN
GDISGLEVRSANSDRGSIDDGGLALLWFGVITSVLALVAINMGGSSFFNP*

DNA
ATGATTCTACAATCTTCTTCTTGTTCTACTTTCGATTTCCCTTCTTTTGTGCCACGTCGTTTGCTCTGCCCTTGCTCCAA
TGAGCACGCTCTGATTGTGTTCTGCGATGGATTCGCGAAGAGGCGGAGAATTCTCCGTCGAGTTCAGGCGGCGAATGCCA
ATTCCAGGTTTGTTTCCAGCGGAAGCCGTACGGATTCCATGAACATTGGATTAGCGAGAAGAGCTGCAAGAAGTCTTGTG
GTTACTCGTTTTTCGAATGAATTCGAGGATGAAGAAGAATCTTCATCTTCACAGGAGTCTGCAATTCAGGGTGATCGAAA
CAGTTTCACTAACTTTAGAGAAGACCCTATAGTGGATAAGCTCAGGACTCACCTAGGTGTAATCCATCCAATCCCCTCGC
CACCGATTAGTCGTAATGCGATTGGTTTATTCGCCTTCTTCTTCTTTGTTGGTGTTATTTGTGACAAGCTATGGACTTGG
AGAAAGCGGCGGAGACAAACCAGCGGTGATGAGGGAGGCCAAAGAGGAGCCCGGCCATGGGCACAAGTTCCCACTAGCTT
CTCGCTGTCCCTTGAGAAGGATTTGCAAAGGAAAGAGTCAGTGGAGTGGGTCAACATGGTGTTGGTGAAGCTCTGGAAAG
TTTATAGAGGTGGGATTGAGAATTGGCTTGTTGGATTGTTGCAGCCTGTCATTGATGACTTGAAGAAGCCAGATTATGTG
CAGAGAGTTGAAATTAAGCAATTCTCTCTTGGGGATGAGCCTTTGTCTGTTAGAAATGTTGAGAGGAGAACATCTCGCCG
TGTTAATGACTTGCAGTACCAGATTGGTCTTCGATATACTGGTGGTGCTCGGATGTTGTTAATGCTCTCTTTAAAATTTG
GTATCATCCCAGTAGTCGTGCCAGTCGGTATTCGGGATTTTGACATTGACGGTGAACTATGGGTTAAATTAAGATTGATT
CCGTCAGCACCTTGGGTTGGAGCAGCATCATGGGCGTTTGTTTCACTCCCAAAGATCAAATTTGAGCTTGCTCCATTCCG
ATTGTTTAATCTAATGGGAATTCCTGTGTTATCAATGTTCTTGACCAAACTGCTGACAGAGGATTTGCCTAGATTATTTG
TCCGCCCAAAGAAAATTGTCTTGGATTTCCAGAAAGGAAAAGCTGTTGGGCCTGTTTCAGAAGACTTAAAATCTGGAGAA
ATGCAGGAAGGGAACAAGGATTTTGTAGGGGAACTGTCTGTTACTCTTGTAAATGCCCAGAAACTTCCATACATGTTCTC
TGGTAGAACGGATCCATATGTTATTTTACGAATAGGTGATCAAGTTATCCGCAGTAAGAAGAACAGTCAAACTACTGTGT
TTGGTGCTCCTGGTCAGCCAATCTGGAATCAGGACTTCCAATTCCTTGTTTCAAATCCTAGAGAGCAAGTATTACAAATT
GAAGTCAACGACTGTCTTGGATTTGCCGATATGGCTATTGGTATCGGAGAGGTTGACCTCGAATCACTGCCAGATACGGT
TCCTACAGACAGATTCGTTAGTTTGCAAGGCGGTTGGAGTTTGTTCGGAAAGGGATCTACTGGAGAAATACTACTCCGGC
TTACATACAAAGCATATGTGGAGGATGAAGAAGATGATAAACGCAATGCAAAAGCCATTTATGCAGATGCTTCCGATGAT
GAAATGTCTGATTCGGAAGAACCTAGCTCATTTGTGCAGAATGACAAGATTCCTTCTGATGATATTGGTCAAGAGTCATT
TATGAACGTGTTGTCTGCATTGATTTTGAGCGAGGAATTTCAAGGCATAGTTTCATCAGAAGCTGGGAACAATAAAGTTG
ATGATCGTGAATCAAGCGTGTCACCTGTTCCTTCAAAGGCTGGGGCGGACTCAAAATCTCGACCAAAAGATGCTGGCAAT
GGGGACATATCAGGTTTGGAAGTGAGAAGCGCGAATTCTGATAGAGGTTCTATTGATGATGGAGGATTAGCATTGTTGTG
GTTCGGTGTAATCACTTCTGTACTGGCGCTCGTTGCTATCAACATGGGCGGCTCAAGTTTCTTCAACCCGTAA