Details for Lyrate rockcress Locus 16055162

Position : sca3 ( 5`- 6476216 .. 6474306 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16055162

Protein [Map View]
MGRKRKHSETVAAAPVKKDDSAPERPKRTLLGWKDKNEDAEDSKPASVFRNKEKVLVTCSRRISFRYRHLMLNMVSLLPH
CKKDSKVEAKSSRGATLNELIELKGSSSCLFFECRKHKDLYMWMVKSPGGPSVKFLVNAVHTMEELKLTGNHLKGSRPLL
TFSSNFEKDAHWKLLKEMLTQIFGIPEGHRKSKPYHDHVFVFSIVDDHIWFRNYQISVPHNESDKIARGDLDKMTLIEVG
PRFCLNPIKIFGGSFGGPTLYENPFYVSPNQIRALEKRNKAGKFAKKIKAKTRRKMHELSNPLEPGEFTDMWKDE*

DNA
ATGGGCAGGAAGAGAAAGCACAGCGAGACTGTTGCGGCGGCACCGGTGAAGAAGGACGATTCTGCTCCGGAGAGACCTAA
AAGGACTCTTTTGGGTTGGAAAGATAAGAACGAAGATGCTGAGGACTCTAAACCTGCGTCTGTATTCAGGAATAAAGAGA
AGGTTCTCGTTACTTGTTCCCGTCGAATCAGTTTCAGGTATCGGCATTTGATGTTGAACATGGTGTCACTTCTACCTCAC
TGTAAGAAGGATAGTAAGGTGGAAGCTAAGAGCAGTAGAGGTGCCACTCTTAATGAGCTCATCGAGCTCAAGGGCTCTTC
TTCCTGTTTGTTTTTCGAGTGTAGGAAGCACAAAGATCTTTACATGTGGATGGTCAAGTCCCCTGGTGGACCTTCCGTTA
AGTTCTTGGTTAATGCTGTTCACACAATGGAGGAGCTGAAACTCACTGGAAATCATCTGAAAGGTTCACGCCCACTTCTG
ACATTCTCATCCAATTTTGAAAAAGATGCACACTGGAAACTTCTTAAAGAGATGTTAACTCAGATTTTTGGAATTCCCGA
GGGACATAGGAAGTCTAAACCTTACCATGATCATGTGTTTGTTTTCTCCATTGTTGATGACCATATATGGTTCCGTAATT
ACCAGATATCGGTACCTCATAACGAGTCAGACAAGATTGCACGAGGCGATCTGGATAAAATGACTCTTATTGAGGTTGGT
CCAAGGTTTTGTTTAAATCCAATTAAGATATTTGGAGGCAGCTTTGGAGGTCCAACGCTTTATGAGAACCCATTCTACGT
TTCTCCAAACCAGATTCGAGCTTTGGAGAAAAGAAATAAAGCCGGGAAATTTGCTAAGAAAATCAAGGCGAAAACAAGAA
GAAAGATGCATGAACTCTCAAACCCATTGGAGCCTGGTGAATTTACAGACATGTGGAAGGATGAATGA