Details for Lyrate rockcress Locus 16055158

Position : sca3 ( 5`- 7651551 .. 7653921 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479277 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16055158

Protein [Map View]
MATSFSKILTKSNAQRHWCSTTTSISASPSLPKQFWSRHFSAVADSSSSTSAALGSQSSSSAPPQENKRGSKWSQLLLFL
PGAITFGLGSWQIVRREEKFKTLEYQQRRLNMEPMKLNIDHPPDKNLDALEFRRVSCKGVFDEQRSIYLGPRSRSISGVT
ENGFYLITPLMPIPGDLDSMQSPILVNRGWVPRSWREKSPESTEADFAANQSTKAESPSNEPKSWWKFWSKTPVITKEHV
SVVKPVEVVGVIRGGENPSIFVPSNDPSSGQWFYVDVPAMARAVGLPENTIYVEDVHEHVDRSRPYPVPKDINTLIRSKV
MPQDHLNYSITWYSLSAAVTFMAYKRLKAKPTRR*

DNA
ATGGCGACATCGTTTTCCAAAATCCTGACGAAATCGAACGCTCAGAGACACTGGTGCTCTACTACAACCAGTATATCTGC
ATCTCCTTCTTTACCGAAACAATTCTGGTCAAGACACTTCTCCGCCGTCGCTGACTCTTCCTCGTCTACCTCCGCCGCTC
TGGGAAGCCAATCGAGTTCTTCTGCTCCACCACAAGAGAATAAACGAGGTTCAAAGTGGTCACAATTGCTGTTATTCTTG
CCTGGAGCGATTACCTTCGGCCTCGGGTCATGGCAGATCGTCAGAAGAGAGGAAAAGTTCAAAACACTGGAGTATCAACA
GCGACGGTTGAACATGGAACCAATGAAGCTAAATATAGACCATCCTCCTGATAAGAATCTTGATGCATTAGAATTTAGAC
GGGTTAGTTGCAAGGGTGTCTTTGACGAGCAAAGGTCTATCTATTTGGGTCCACGGTCTAGGTCCATTTCGGGAGTTACT
GAAAATGGATTCTATCTCATCACACCTCTAATGCCAATCCCCGGTGACCTGGATAGCATGCAGTCGCCTATTCTGGTGAA
TCGTGGATGGGTTCCTCGAAGTTGGAGAGAGAAGTCACCAGAATCCACAGAGGCCGACTTCGCTGCAAACCAGTCAACAA
AAGCTGAATCACCCTCCAATGAACCAAAGTCCTGGTGGAAATTTTGGTCTAAGACACCAGTGATTACCAAGGAACATGTA
TCCGTGGTTAAGCCTGTAGAAGTTGTTGGTGTGATCAGGGGAGGGGAGAACCCGAGCATATTTGTTCCATCCAATGATCC
AAGTAGCGGGCAGTGGTTCTATGTAGATGTTCCAGCGATGGCTCGAGCCGTTGGCCTTCCTGAAAACACAATCTACGTAG
AGGACGTCCATGAACATGTAGATCGGAGTAGACCGTATCCTGTTCCCAAGGACATCAACACCTTGATCCGCAGTAAAGTG
ATGCCACAGGACCATCTCAACTACTCAATAACATGGTATTCTCTCTCCGCGGCTGTCACTTTCATGGCTTACAAGAGACT
GAAGGCAAAGCCTACCCGCAGATAA