Details for Lyrate rockcress Locus 16055122

Position : sca3 ( 5`- 923030 .. 930807 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_896304 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16055122

Protein [Map View]
MAAEKLRDLSQPIDVVLLDAIVEAFYATGSKEERASADTILRDLKANPDTWLQVVHILQNTSSTHTKYFALQVLEGVIKY
RWNALPVEQRDGMKNYISDIIVQLSRDEASFRTERLYVNKLNVILVQIVKHEWPAKWKSFIPDLVIAAKTSETICENCMA
ILKLLSEEVFDFSRGEMTQQKIKELKQSLNSEFQLIHELCLYVLSASQRQELIRATLSALHAYLSWIPLGYIFESPLLET
LLKFFPVPAFRNLTLQCLSEVASLNFGDFYNVQYVKMYSIFMNQLQAILPINLNIPEAYSTGSSEEQAFIQNLALFFTSF
FKLHIKILESAPENISLLLAGLGYLISISYVDDTEVFKVCLDYWNSLVLELFGAQHHAGHPALTPTLFGLQMSFLPITVD
GVKPEVTERHQLYSDPMSKLRGLMISRMAKPEEVLIVEDENGNIVRETMKDNDVLVQYKIMRETLIYLSHLDHEDTEKQM
LSKLSKQLSGEEWAWNNLNTLCWAIGSISGSMVVEQENRFLVLVIRDLLSLCEVVKGKDNKAVIASNIMYVVGQYSRFLR
AHWKFLKTVVHKLFEFMHETHPGVQDMACDTFLKIVQKCKRKFVIVQVGESEPFVSELLSGLATIVGDLQPHQIHTFYES
VGSMIQAESDPQKRGEYLQRLMALPNQKWAEIIGQARQSADILKDPDVIRTVLNILQTNTRVATSLGTFFLSQISLIFLD
MLNVYRMYSELVSSSIANGGPYASRTSLVKLLRSVKREILKLIETFLDKAENQPHIGKQFVPPMMDQVLGDYARNVPDAR
ESEVLSLFATIINKYKVVMRDEVPLIFEAVFQCTLEMITKNFEDYPEHRLKFFSLLRAIATFCFRALIQLSSEQLKLVMD
SVIWAFRHTERNIAETGLNLLLEMLKNFQKSDFCNKFYQAYFLQIEQEVFAVLTDTFHKPGFKLHVLVLQHLFSLVESGS
LTEPLWDAATVTHPYPNNVAFVLEYTTKLLSSSFPNMTTTEVTQFVNGLYESRNDAGRFKNNIRDFLVQSKEFSAQDNKD
LYAEEAAAQMERERQRMLSIPGLIAPSEIQDDMADS*

DNA
ATGGCTGCCGAGAAGTTAAGAGACTTGAGTCAGCCAATTGACGTCGTTTTACTCGATGCCATTGTTGAGGCCTTTTACGC
TACCGGATCTAAGGAAGAAAGAGCTTCTGCGGATACTATCTTGCGGGATTTGAAAGCTAATCCTGATACTTGGCTTCAAG
TGGTTCACATTCTACAGAACACCAGTAGTACACATACAAAATATTTTGCCCTTCAGGTGCTAGAAGGTGTTATAAAGTAT
AGGTGGAATGCATTACCCGTTGAACAACGTGATGGAATGAAAAATTACATCTCTGATATCATTGTGCAGCTCTCAAGGGA
TGAAGCATCTTTCAGAACGGAAAGGCTTTATGTCAACAAGTTAAATGTCATCCTGGTCCAGATCGTGAAACATGAGTGGC
CGGCAAAGTGGAAAAGCTTTATTCCTGATCTAGTTATAGCTGCAAAGACTAGTGAAACTATCTGTGAGAATTGCATGGCC
ATTTTGAAACTCCTAAGTGAAGAGGTCTTTGATTTCTCAAGAGGAGAGATGACTCAGCAAAAGATAAAAGAACTGAAACA
GTCTCTAAACAGCGAGTTTCAACTCATTCACGAGTTATGCCTATATGTCCTCTCAGCTTCCCAAAGACAAGAACTTATAC
GTGCAACACTCTCTGCATTGCATGCCTATCTTTCTTGGATTCCGTTGGGATACATATTTGAGTCCCCTTTGCTGGAGACC
CTACTTAAATTCTTCCCTGTTCCAGCATTTAGGAATCTCACACTTCAATGTCTGTCAGAGGTTGCATCTCTCAACTTTGG
GGACTTCTACAATGTGCAATATGTCAAGATGTACAGCATTTTCATGAATCAGTTGCAGGCAATTCTCCCTATAAATTTAA
ATATCCCTGAGGCATATTCAACTGGAAGTAGTGAAGAACAGGCTTTTATCCAGAACTTGGCACTGTTTTTCACTTCGTTT
TTCAAGTTACATATAAAAATCCTAGAATCTGCACCCGAGAATATTTCTCTATTACTTGCGGGTCTGGGATATCTCATTAG
CATATCGTATGTTGATGACACTGAAGTATTCAAGGTTTGTTTGGACTATTGGAATTCATTAGTTTTGGAGTTGTTTGGGG
CGCAACATCATGCTGGTCACCCTGCACTAACTCCAACTCTGTTTGGATTGCAAATGTCTTTCCTTCCTATCACAGTTGAT
GGTGTTAAACCTGAAGTCACGGAGCGGCATCAACTTTATTCAGATCCAATGTCAAAATTAAGGGGACTCATGATTAGTCG
CATGGCTAAGCCTGAAGAAGTGTTAATTGTTGAGGACGAAAATGGGAACATTGTCCGTGAAACTATGAAGGATAATGATG
TTCTTGTCCAGTATAAGATAATGCGAGAGACATTAATCTACCTCTCACATCTTGATCATGAAGATACCGAAAAACAGATG
TTGAGTAAGCTAAGCAAACAGTTGAGTGGAGAGGAATGGGCATGGAACAATCTGAACACTTTATGCTGGGCGATTGGGTC
TATTTCTGGGTCCATGGTAGTAGAACAGGAAAACAGATTTCTCGTGTTGGTTATCCGTGATTTGTTAAGTTTATGTGAAG
TCGTCAAGGGAAAAGACAATAAAGCTGTTATTGCGAGCAACATCATGTATGTTGTTGGACAATATTCAAGATTCTTAAGA
GCCCATTGGAAGTTTTTGAAGACAGTTGTCCATAAGTTGTTTGAATTTATGCATGAGACGCATCCTGGTGTTCAGGATAT
GGCTTGTGACACATTCTTAAAAATTGTTCAGAAGTGTAAACGAAAATTCGTTATTGTTCAGGTTGGAGAAAGTGAGCCAT
TTGTATCTGAACTTCTATCAGGCCTTGCTACAATCGTCGGAGATCTTCAACCTCATCAGATTCATACATTTTATGAATCT
GTTGGTAGTATGATTCAGGCAGAATCAGATCCTCAGAAGAGGGGGGAATACCTCCAGAGGTTGATGGCTCTCCCGAATCA
GAAATGGGCAGAAATAATAGGACAAGCACGTCAAAGTGCAGATATCCTCAAGGACCCAGATGTGATACGTACTGTGCTTA
ATATCCTCCAGACAAATACGCGCGTTGCAACTTCATTAGGAACATTCTTCCTCTCTCAAATTTCGTTGATCTTCTTGGAT
ATGCTGAATGTTTACAGAATGTATAGTGAACTCGTGTCAAGCAGCATTGCTAATGGTGGCCCATACGCTTCGAGAACATC
TCTTGTTAAACTTTTAAGGTCTGTTAAGAGGGAAATCCTTAAGCTGATAGAGACGTTTTTAGACAAAGCTGAAAACCAGC
CACACATTGGAAAACAGTTTGTTCCACCAATGATGGATCAAGTACTTGGCGACTATGCAAGAAATGTTCCTGATGCAAGA
GAATCAGAAGTCTTATCACTCTTTGCGACAATAATAAACAAGTACAAGGTTGTAATGCGAGATGAAGTTCCCCTCATATT
TGAAGCTGTTTTCCAGTGCACATTGGAGATGATTACTAAGAATTTTGAAGATTACCCAGAGCACCGTCTCAAGTTTTTCT
CGTTACTGCGTGCTATTGCTACATTTTGTTTCCGTGCGTTGATACAGTTGTCAAGTGAGCAACTGAAGCTAGTGATGGAT
TCAGTTATCTGGGCATTTAGGCATACCGAAAGAAATATCGCTGAAACTGGGCTCAATCTCTTGCTCGAGATGCTGAAAAA
CTTTCAGAAATCTGACTTCTGTAACAAATTCTACCAAGCATACTTTCTACAAATTGAGCAAGAAGTATTTGCTGTTTTGA
CCGATACCTTCCATAAGCCTGGGTTCAAGTTGCATGTGTTGGTGCTGCAGCACTTATTTAGCCTGGTTGAGAGTGGATCG
TTGACAGAACCATTGTGGGATGCTGCAACGGTAACTCATCCTTATCCAAATAATGTCGCCTTTGTGCTTGAGTACACCAC
CAAGCTTCTAAGCTCATCATTCCCTAACATGACTACAACAGAGGTGACACAGTTTGTGAATGGACTTTACGAGTCGAGAA
ACGATGCTGGCAGATTTAAGAATAACATACGCGACTTCCTTGTACAGTCCAAGGAATTTTCTGCTCAGGATAACAAAGAT
TTATATGCTGAGGAAGCTGCTGCCCAAATGGAGAGAGAGAGACAAAGAATGCTTTCGATTCCTGGACTTATAGCGCCCAG
CGAAATTCAAGACGACATGGCTGATTCTTAA