Details for Lyrate rockcress Locus 16055111

Position : sca3 ( 5`- 8871766 .. 8871053 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479554 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16055111

Protein [Map View]
VGPALPVTAGGSVKEPRYRGVRKRPWGRFAAEIRDPLKKSRVWLGTFDSAIEAARAYDTAARNLRGPKAKTNFPIDCSPS
SPLQPLNYLQNQNLCSPAANQNQIDPFMDHRLYGGGNFQEQQQIISRPASSSMSSTVKSCSGPRPMEAAAASSSVAKPLH
AIKRYPRTPPVAPEDCHSDCDSSSSVIDDGDDIASSSSRRKPPFQFDLNFPPLDGVDLFAGGTDDLHCTDLRL*

DNA
GTTGGACCCGCCCTTCCAGTAACCGCCGGTGGATCTGTGAAGGAGCCGAGGTATAGAGGCGTTAGGAAGAGACCTTGGGG
TCGATTCGCGGCTGAGATCCGTGATCCATTAAAGAAGTCTCGTGTTTGGCTCGGTACTTTCGATTCCGCCATAGAAGCTG
CACGCGCTTACGATACCGCCGCACGTAACCTCCGTGGTCCAAAGGCTAAGACCAATTTCCCGATCGATTGCTCTCCTTCT
TCTCCTCTCCAACCTCTCAACTACCTCCAGAATCAGAACCTCTGTTCTCCTGCGGCGAATCAGAACCAGATCGATCCGTT
TATGGACCATCGGTTATACGGCGGAGGTAATTTTCAGGAGCAGCAACAGATTATTAGTCGGCCGGCGAGTAGCAGTATGA
GCAGCACCGTCAAATCGTGTAGCGGACCGAGACCGATGGAAGCCGCGGCGGCGTCTTCGTCGGTGGCGAAACCGTTACAT
GCGATAAAGAGATATCCGAGGACTCCACCGGTGGCTCCGGAGGATTGTCATAGCGATTGCGATTCTTCGTCGTCGGTTAT
TGACGACGGAGATGATATAGCATCTTCGTCTTCGCGCCGGAAACCGCCGTTTCAGTTTGATCTTAATTTCCCGCCGTTGG
ATGGCGTTGACTTATTCGCTGGCGGGACAGATGATCTCCACTGTACCGATCTACGTCTATGA