Details for Lyrate rockcress Locus 16055085

Position : sca3 ( 5`- 1013763 .. 1011099 -3` )
Annotation : [B2G] short-chain dehydrogenase reductase family protein
External links : CoGe
PGDD synteny : 16055085

Protein [Map View]
MLTLLFFSLGVLLIGLLFKFALADGDFTLISKKHAKREAIQGKVVWITGASRGIGEILAKQFASLDAKLILSARNKAELE
RVKSELKGKYAPEDVKVLPLDLASGEESLKHVVEQAVSLFPGAGVDYLVHNAAYERPKSKASDASEETLKTTFDVNVFGT
ITLTKLVAPHMLKQGGGHFVVISSAAGKVPSPGQAIYSASKHALHGYFHSLRSEFCQEGIKVTVVCPGPIETLNGTGTST
SEDKKSPEKRVSSERCAELTIIAASHNLKEAWISYQPVLLVMYLVQYMPSLGFWLMDKVGGKRVEVAEKKGNTYSWNLLF
GKKTKTN*

DNA
ATGCTGACTCTACTCTTCTTCTCTCTCGGAGTCCTTCTTATCGGTCTGCTATTCAAATTCGCACTTGCCGATGGAGATTT
TACCCTGATTTCGAAGAAGCATGCGAAGCGTGAAGCCATACAAGGAAAGGTCGTCTGGATCACAGGGGCTAGCCGTGGAA
TTGGGGAAATTCTTGCTAAACAGTTTGCAAGTTTAGATGCCAAGCTTATTCTCTCTGCGAGGAATAAAGCTGAATTGGAG
AGAGTTAAGAGTGAGCTCAAAGGTAAATATGCACCAGAAGATGTCAAGGTTTTACCTTTAGATTTAGCTAGTGGTGAAGA
GTCGCTCAAACATGTTGTAGAGCAAGCTGTTTCGCTTTTCCCTGGGGCTGGTGTTGATTATTTGGTTCATAACGCTGCCT
ATGAGCGTCCGAAATCCAAGGCTTCAGATGCAAGTGAGGAAACTCTCAAGACTACATTCGATGTTAATGTCTTTGGGACG
ATAACTCTTACAAAGTTGGTAGCTCCTCATATGCTAAAACAAGGAGGTGGTCATTTTGTTGTGATAAGCAGTGCTGCAGG
AAAGGTACCATCACCTGGACAGGCTATATATTCTGCTTCAAAACATGCTCTGCACGGCTATTTCCACAGCTTGCGTTCTG
AGTTCTGTCAGGAGGGAATCAAGGTTACCGTCGTTTGTCCTGGTCCAATAGAAACCTTGAATGGTACAGGAACATCAACT
TCGGAAGACAAGAAGTCTCCTGAGAAGCGTGTGTCATCTGAACGATGTGCAGAACTGACTATAATCGCTGCTTCTCATAA
CTTGAAGGAAGCTTGGATTTCATATCAGCCGGTACTGCTCGTGATGTATCTAGTTCAGTACATGCCTTCCCTTGGCTTCT
GGCTCATGGACAAGGTTGGAGGGAAGCGTGTGGAGGTCGCAGAAAAGAAAGGCAACACATACTCATGGAATTTACTGTTC
GGGAAGAAGACTAAAACAAACTGA