Details for Lyrate rockcress Locus 16055081

Position : sca5 ( 5`- 17858049 .. 17858916 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16055081

Protein [Map View]
MVSREHKRGSSLREKFHLLRSITNSHAESETSVIVDASKYIKKLKQKVEKINNETTSEQSFRESSDPNPMVTVETLENGF
MIKVMSVKNEAGMLVCVLETFEDLGLDVVEARVSCTDTFSLHAIGSSNNNDGDIMDAEAVKQAVTEAIRTWSDSHA*

DNA
ATGGTTTCGAGGGAACACAAGAGAGGTTCCTCTCTGCGTGAGAAGTTTCATTTGCTTCGTTCAATCACTAATTCTCATGC
TGAGAGCGAAACATCTGTCATAGTGGATGCATCAAAATATATCAAAAAGCTTAAGCAGAAAGTAGAAAAAATCAACAATG
AGACCACGTCTGAGCAATCTTTCCGCGAATCTTCCGATCCAAATCCTATGGTTACAGTGGAAACCCTAGAGAACGGGTTC
ATGATAAAGGTAATGTCAGTGAAGAATGAGGCAGGCATGTTGGTTTGTGTTCTTGAAACCTTTGAAGATCTTGGACTTGA
TGTTGTTGAAGCTAGGGTTTCATGTACAGACACATTTAGCTTACATGCCATTGGTTCATCAAATAATAATGATGGAGACA
TCATGGATGCTGAAGCAGTGAAACAGGCAGTGACAGAAGCAATCAGGACCTGGAGTGATAGCCATGCATGA