Details for Lyrate rockcress Locus 16055056

Position : sca3 ( 5`- 7739573 .. 7743445 -3` )
Annotation : [B2G] MYB4R1 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16055056

Protein [Map View]
MNRNSLYEADDDDDDDEEDDIGEDLEDLRRACMVSDVNSDKFAAKTGSIEPDGGGGGEMPSDSENEDDFEMLRSIKSQLA
SSKDADLSSGPPIGLSLLSDSESEDDFELIRSIKSQLALSMDVSLPPIGLSDDDEDDAFETLRAIRRRFSAYKNFDSEGN
FMNDSPGKKKQVHDLDNEPSSELLSRSNTCESFPDHGKSVVTVPDSEDVHEKTSIEPPDHLETCQVSAASSSFPKAALAF
VDAIRRNRAYQKFLRRKLVEIEATIEQNEKHKKNVKIVKDFQASCKRITKLALSQKKDPRVELISTRKSEPCDSSEGNDK
KISPLMLGPAENPCVANYRMVLEKYPISVERRKWSTEENKKLAKGLKQEVQKILLSEAIEQSSDLEGSIYDIDTINESIG
NLEITPEMIRQFLPKINWDLLDIKDRSAAECEARWMSSEDPLINHGPWTAAEDKNLLRIIEKKSLTDWVDIAVSLGTNRT
PFQCLTRYQRSLNPSILKKEWTAEEDDQLRAAVELFGDKDWQSVANVLKGRTGPQCSNRWKKSLRPTRKGTWSLEEDKRV
KVAVTLFGSQNWHKISQFVPGRTQTQCRERWLNCLDPKVNRGKWTEEEDRKLREAIAEHGYSWSKVASKLSCRTDSQCLR
RWKRLYPHQVALLQEARRLQKEGSVGNFVDRESERPSLVTGAILALPEISLEPEPDSVTVKKKRKAKEKKSDAERQPKRR
RKALKKCSGDVCRQENETVCENEPNNEGEERLLELECHNEILGNAKEKQRRKRKSVAETSNNNTGLKKLTPRRKKVSAVV
PKKNQDAPN*

DNA
ATGAATCGGAACAGCCTATACGAAGCTGATGACGATGATGACGATGACGAAGAAGATGACATCGGTGAAGACCTCGAAGA
TTTAAGACGCGCCTGCATGGTCTCTGACGTTAATTCCGATAAATTCGCGGCAAAAACCGGTTCAATTGAACCGGATGGAG
GCGGTGGCGGAGAGATGCCGTCGGATTCAGAAAACGAAGATGACTTTGAGATGCTTCGTAGCATTAAGAGCCAATTAGCA
TCTTCCAAAGATGCAGATTTAAGCAGTGGTCCTCCCATTGGTTTATCTTTGCTCTCGGATTCGGAGAGTGAAGATGATTT
CGAGTTGATTCGGAGCATTAAGAGCCAATTGGCATTGTCCATGGATGTGTCTCTTCCTCCAATTGGTTTATCTGACGATG
ACGAAGATGATGCCTTTGAAACCCTTCGAGCTATTCGTAGGCGATTCTCTGCTTATAAGAATTTCGATTCGGAAGGAAAT
TTCATGAATGATTCTCCCGGGAAGAAAAAGCAGGTACATGACTTGGATAATGAACCTTCAAGCGAATTATTGAGTAGATC
TAATACTTGTGAAAGCTTTCCAGATCACGGGAAATCAGTTGTCACAGTGCCAGATTCAGAGGACGTACATGAAAAGACTT
CCATTGAACCTCCTGACCACCTGGAGACATGCCAGGTATCAGCTGCGAGTTCAAGTTTCCCTAAAGCTGCACTAGCCTTT
GTTGATGCAATCAGGAGGAACAGGGCATATCAGAAATTTCTTAGAAGAAAATTGGTAGAAATTGAAGCAACGATCGAGCA
GAACGAGAAACACAAGAAAAATGTTAAAATAGTTAAAGATTTTCAAGCTTCTTGCAAGAGAATTACTAAACTGGCACTCT
CTCAGAAGAAAGATCCTCGTGTCGAGTTAATCTCAACACGAAAATCTGAGCCTTGTGATAGCTCCGAGGGTAATGATAAA
AAGATATCTCCTTTGATGTTGGGTCCAGCGGAAAACCCTTGTGTTGCAAATTATAGGATGGTACTAGAGAAATATCCAAT
TTCAGTGGAACGCAGAAAATGGTCTACTGAGGAGAACAAAAAACTTGCAAAAGGTCTAAAACAAGAAGTTCAAAAAATAC
TGCTCTCTGAAGCTATTGAACAGTCCAGTGACTTGGAAGGATCTATATATGATATAGACACCATCAATGAATCGATCGGA
AATCTTGAGATCACACCAGAAATGATTAGACAGTTTCTTCCGAAAATTAACTGGGATTTGTTGGATATCAAGGACCGTTC
TGCTGCAGAATGTGAAGCTCGGTGGATGAGCTCGGAAGATCCATTGATTAACCACGGTCCGTGGACTGCAGCAGAGGACA
AAAACCTACTCCGAATTATCGAAAAAAAGAGTCTTACAGACTGGGTTGATATTGCGGTCTCACTAGGGACAAATAGGACC
CCATTTCAATGTTTGACTCGATATCAGAGAAGCTTGAATCCAAGCATATTGAAAAAAGAATGGACTGCAGAGGAAGATGA
TCAACTTCGTGCTGCAGTAGAGTTATTTGGCGATAAAGACTGGCAATCTGTTGCAAATGTATTAAAAGGAAGAACTGGAC
CTCAGTGCTCGAATAGATGGAAAAAGTCGCTTCGCCCGACCAGAAAAGGGACATGGAGCTTAGAGGAAGACAAGCGTGTG
AAAGTAGCTGTGACACTCTTTGGATCTCAAAACTGGCATAAGATTTCTCAGTTTGTTCCTGGACGGACCCAGACTCAGTG
TCGGGAGAGATGGTTAAATTGTTTAGATCCCAAAGTAAATCGTGGGAAGTGGACTGAGGAAGAGGATAGAAAGTTGAGAG
AAGCAATTGCAGAACATGGATATAGCTGGTCTAAGGTTGCTTCTAAACTGTCTTGTCGTACTGACAGTCAGTGCTTGAGG
AGATGGAAGAGATTATATCCTCATCAAGTGGCTCTTTTACAAGAAGCTAGAAGGTTACAAAAAGAAGGTAGTGTAGGTAA
TTTTGTTGACCGGGAATCAGAGCGTCCTTCTCTTGTCACAGGCGCTATTTTGGCACTGCCGGAGATATCTCTAGAGCCAG
AACCCGATAGTGTAACTGTGAAGAAGAAACGCAAGGCCAAAGAGAAGAAGTCAGATGCAGAGAGACAACCAAAGAGACGG
AGAAAAGCATTAAAGAAATGCTCAGGAGATGTATGTAGACAAGAGAATGAGACTGTTTGTGAAAATGAACCAAACAATGA
AGGAGAGGAGAGGTTGTTGGAATTGGAATGTCATAACGAGATCCTAGGCAATGCAAAGGAGAAACAAAGACGAAAACGCA
AAAGTGTTGCAGAAACATCGAACAACAACACTGGTTTAAAAAAACTTACGCCTAGGAGAAAGAAAGTGTCTGCAGTAGTT
CCTAAAAAGAACCAAGATGCACCAAATTAG