Details for Lyrate rockcress Locus 16055035

Position : sca3 ( 5`- 10443867 .. 10442127 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16055035

Protein [Map View]
MDMFMDFFNKPSVTETFVDILLCAVPIWVAVMIGLLIGWSWRPRWTGLVYLGFRSKLRFLLTAPPGFGARRIWLAFTALS
VFSVCRTLWSKIGSTSKRSSVNNGLAPSSKPVEEEAVSDIVTEKEQDVVTEKDLEHLLYLLKDGNANLEWQSMMDKSTPN
MSYQAWRHEPETGPVVYRSRTVFEDATPDIVRDFFWDDEFRPKWDPMLAYFKTLEEDPHTGTTIVHWIKKFPFFCSDREY
IIGRRIWESGKKYYAVTKGVPYQALPKRDKPRRVEVYFSSWIIKAVESRKRDGQLSACEVSLVHYEDMGIPKDVAKLGVR
HGMWGAVKKLNSGLRAYQSARKPGTSLSRSAQMASITTKLNMDLVETSGAEEEERGRAVENARKQKDQVSVDWKWIVVGG
VALACGLHSSAIGKALMVGAGHRLARR*

DNA
ATGGATATGTTCATGGATTTCTTCAATAAACCTTCTGTTACAGAAACATTCGTCGACATTTTGCTATGTGCAGTTCCGAT
TTGGGTCGCTGTTATGATCGGGCTTTTGATTGGTTGGTCTTGGCGTCCACGCTGGACTGGCTTGGTTTATTTAGGGTTCC
GTTCTAAGCTTCGGTTTCTATTGACTGCTCCTCCTGGTTTTGGTGCTCGTCGTATTTGGCTTGCTTTCACCGCTCTCTCT
GTTTTTTCCGTTTGTCGTACTCTTTGGTCAAAAATCGGTTCTACTTCCAAGAGATCGTCGGTTAATAACGGTTTAGCTCC
GTCGTCTAAACCGGTTGAGGAAGAAGCAGTTAGTGATATAGTTACAGAGAAAGAGCAAGATGTTGTGACAGAGAAGGATT
TAGAGCATTTGTTGTATCTGCTTAAAGATGGAAATGCTAATTTGGAGTGGCAATCTATGATGGATAAGTCTACTCCTAAT
ATGAGTTATCAAGCTTGGCGGCATGAGCCTGAGACTGGTCCGGTTGTTTATCGTAGTCGAACTGTTTTTGAGGATGCAAC
ACCAGACATTGTTAGGGATTTCTTCTGGGATGATGAGTTTCGACCTAAATGGGATCCGATGCTTGCTTACTTCAAAACCT
TGGAGGAAGATCCTCACACAGGAACTACCATTGTTCACTGGATTAAAAAGTTCCCATTTTTCTGTAGTGACCGGGAATAC
ATTATTGGCAGGAGAATATGGGAGTCTGGAAAAAAGTATTATGCTGTGACAAAGGGAGTACCTTATCAAGCTCTACCAAA
GCGTGATAAGCCGAGGCGAGTAGAGGTTTATTTCTCAAGTTGGATTATTAAAGCAGTTGAATCCAGAAAGAGGGATGGGC
AGTTATCAGCTTGTGAAGTCTCCCTTGTCCACTATGAAGACATGGGAATCCCAAAAGATGTAGCAAAGTTAGGAGTCCGT
CATGGCATGTGGGGAGCCGTAAAGAAGCTAAACTCCGGCTTAAGGGCATACCAAAGCGCTAGAAAACCTGGGACGTCTCT
TTCACGGAGTGCGCAGATGGCAAGTATCACCACAAAACTGAACATGGATTTGGTGGAAACATCTGGAGCAGAGGAAGAAG
AGAGAGGACGTGCAGTGGAGAATGCGAGGAAACAGAAGGATCAGGTCAGTGTAGATTGGAAATGGATTGTTGTAGGAGGA
GTGGCTTTGGCTTGTGGGCTTCATTCTAGTGCTATAGGCAAGGCGTTAATGGTTGGAGCTGGGCACAGACTTGCTCGTAG
GTGA