Details for Lyrate rockcress Locus 16055030

Position : sca1 ( 5`- 7761901 .. 7764803 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16055030

Protein [Map View]
MASVLLPLPQLSVLFDYRRSRKESSFPRADYNSNAISSNSTNANHFLRRISNFCETGDLDKSFRVVQEFAGDDESSSDVF
LLVREALGLLLQASGKRKDIEMGRKIHHLVSGSTRLRSDDVLCTRIITMYAMCGSPDDSRSAFDALRSKNLFQWNAVISS
YSRNELYHEVLEMFIKMISKTHLLPDNFTFPCVIKACAGISDVGIGLAVHGLVVKTGLVEDLFVGNALVSFYGTHGFVSD
ALKLFDIMPERNLVSWNSMIRVFSDNGDDGAFMPDVATVVTVLPVCAREREIGVGKGVHGWAVKLSLDKELVVNNALMDM
YSKWGCIIDSQMIFKLNNNKNVVSWNTMVGGFSAEGDIHGTFDLLRQMLAGSEDVKADEVTILNAVPVCFDESVLPSLKE
LHCYSLKQEFVYDELLANAFVASYAKCGSLSYAQRVFHGIRSKTLNSWNALIGGYAQSSDPRLSLDAHLQMKNSGLLPDN
FTVCSLLSACSKLKSLRLGKEVHGFIIRNWLERDLFVYLSVLSLYIHCGELCTVQVLFDAMEDNSLVSWNTVITGHLQNG
FPERALGLFRQMVLYGIQPCGISMMTVFGACSLLPSLRLGREAHAYALKHLLEDNAFIACSIIDMYAKNGAITQSSKVFN
GLKEKSAASWNAMIMGYGMHGRAKEAIKLFEEMQRTGRNPDDLTFLGVLTACNHSGLLHEGLRYLDQMKSSFGLKPNLKH
YACVIDMLGRAGQLDNALRVAAEMSEEPDVGIWNSLLSWCRIHQNLEMGEKVAAKLFVLEPEKPENYVLLSNLYAGLGKW
DDVRQVRQRMKEMSLRKDAGCSWIELNGKVFSFVVGERFLDGFEEIKSLWSILEMKIWKMGYRPDTSSVQHDLSEEEKIE
QLRGHSEKLAITYGLIKTSEGTTLRVYKNLRICVDCHNAAKLISKVMEREIVVRDNKRFHHFNKGFCSCGDYW*

DNA
ATGGCTTCTGTTCTGCTTCCATTGCCACAATTATCCGTATTGTTTGATTATCGCCGGAGCCGTAAAGAGTCAAGCTTTCC
TCGCGCCGACTACAATTCCAACGCCATTTCTTCTAATTCGACCAACGCCAATCATTTCCTTCGTCGGATTTCTAACTTCT
GTGAAACCGGAGACCTCGACAAGTCCTTTCGAGTTGTCCAGGAATTCGCTGGTGATGACGAGAGCTCGTCCGATGTGTTT
CTTCTTGTCCGAGAAGCTCTCGGGCTTCTCTTACAAGCTTCTGGGAAGAGAAAAGACATTGAAATGGGGAGAAAGATCCA
CCATTTGGTTTCTGGGTCGACCCGGTTAAGGAGTGATGACGTTCTCTGCACCCGTATTATCACCATGTACGCTATGTGTG
GCTCTCCTGATGATTCTCGTTCTGCTTTTGATGCCTTGCGGAGTAAGAATCTCTTCCAGTGGAATGCTGTGATCAGCTCT
TACTCAAGAAACGAGCTTTACCATGAAGTGTTAGAGATGTTTATCAAGATGATCTCAAAGACTCATCTTTTACCGGATAA
TTTCACTTTTCCATGTGTGATTAAGGCTTGTGCTGGGATTTCTGATGTTGGGATTGGGCTTGCGGTTCATGGGTTGGTGG
TGAAGACCGGATTGGTGGAAGATCTTTTTGTGGGTAACGCATTGGTGTCTTTCTATGGAACACATGGTTTTGTTTCTGAT
GCCTTGAAACTGTTCGATATAATGCCTGAGAGAAACTTGGTTTCCTGGAACTCAATGATTCGAGTGTTTTCTGATAATGG
TGATGATGGTGCGTTTATGCCGGATGTTGCTACAGTTGTTACTGTGTTGCCGGTTTGTGCAAGAGAAAGAGAAATAGGGG
TGGGGAAAGGTGTTCATGGGTGGGCGGTGAAACTGAGTTTGGACAAGGAACTAGTCGTTAACAATGCCTTAATGGACATG
TACTCTAAATGGGGCTGTATAATTGATTCACAAATGATCTTTAAGTTGAACAATAACAAGAATGTGGTTTCTTGGAATAC
AATGGTAGGTGGCTTTTCAGCAGAGGGGGACATACATGGGACGTTTGATCTTCTGAGACAGATGCTGGCAGGAAGCGAAG
ACGTCAAAGCGGACGAGGTAACCATTCTAAATGCAGTGCCAGTTTGTTTTGATGAATCAGTCTTACCGAGCTTGAAGGAA
CTTCATTGTTACTCCTTAAAACAAGAATTTGTATACGATGAGTTATTAGCCAATGCCTTTGTTGCTTCTTATGCAAAGTG
TGGCTCACTGAGTTATGCCCAGCGTGTGTTTCATGGAATAAGGAGTAAAACATTGAACTCTTGGAATGCTTTGATTGGCG
GCTATGCTCAGAGCAGTGATCCGAGATTGTCCTTGGATGCCCATTTGCAGATGAAAAATTCTGGATTGCTACCTGATAAT
TTTACTGTCTGCAGTCTTCTCTCAGCTTGTTCTAAACTAAAATCCCTGCGGTTGGGAAAGGAAGTGCATGGGTTTATAAT
CCGAAATTGGTTAGAAAGAGATTTGTTTGTTTATTTATCAGTACTCTCATTATACATTCATTGTGGGGAGCTATGCACTG
TACAGGTATTATTTGATGCAATGGAAGATAATAGCTTAGTATCTTGGAATACTGTAATCACTGGACACCTTCAGAATGGA
TTTCCTGAGAGAGCTTTGGGTTTGTTTAGACAAATGGTTTTGTATGGAATCCAGCCTTGTGGGATTTCTATGATGACTGT
GTTTGGTGCGTGTTCGCTGCTACCTTCTCTTCGACTGGGGAGAGAAGCGCATGCTTACGCTTTGAAGCACCTCCTGGAGG
ACAATGCGTTTATTGCATGTTCTATAATTGATATGTATGCCAAGAATGGTGCTATAACGCAATCATCTAAGGTTTTTAAC
GGCTTGAAGGAGAAAAGTGCAGCGTCATGGAATGCCATGATAATGGGATATGGAATGCATGGGCGAGCAAAAGAGGCTAT
CAAACTCTTTGAAGAGATGCAAAGAACAGGTCGTAACCCTGATGACTTAACTTTCTTAGGTGTTCTAACGGCTTGCAACC
ACAGTGGTCTGCTCCATGAAGGGCTGAGATATCTGGATCAGATGAAGTCTTCCTTTGGGCTAAAGCCAAATTTAAAGCAT
TACGCTTGTGTCATTGACATGCTAGGCCGAGCTGGGCAACTAGACAATGCTCTAAGGGTTGCTGCAGAGATGTCTGAGGA
ACCTGACGTTGGAATTTGGAATTCTCTGCTCAGCTGGTGCAGAATCCATCAAAATCTGGAAATGGGAGAGAAAGTTGCTG
CTAAGTTATTTGTATTAGAACCAGAAAAGCCTGAGAATTATGTTCTGCTTTCCAACTTATATGCAGGATTGGGGAAATGG
GATGATGTGAGACAAGTGAGGCAGAGAATGAAGGAGATGAGTTTACGAAAGGATGCTGGATGCTCTTGGATCGAACTAAA
CGGAAAGGTTTTTAGCTTTGTTGTCGGTGAAAGATTCTTAGATGGTTTTGAGGAAATCAAAAGTCTTTGGAGTATATTGG
AGATGAAGATATGGAAGATGGGATACAGACCAGACACAAGTTCAGTACAACATGATCTAAGTGAAGAGGAGAAGATCGAA
CAGTTAAGGGGACACAGCGAGAAGCTTGCCATTACCTATGGATTGATCAAAACTTCAGAAGGAACAACTCTTAGAGTTTA
CAAGAACTTAAGGATCTGTGTGGACTGTCACAATGCAGCGAAGTTGATCTCCAAAGTCATGGAAAGGGAAATAGTTGTGA
GAGACAACAAAAGATTTCATCATTTCAATAAGGGGTTTTGTTCTTGTGGAGATTACTGGTAA