Details for Lyrate rockcress Locus 16055021

Position : sca3 ( 5`- 7521339 .. 7520158 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16055021

Protein [Map View]
MMSDLPSDLAEEVLSRLPVTSLRGFRAACKKWNTLSKERSFTRKHLAQAKAAAAREFMVVMVMNSRVYLMGINLHGVHES
VDPSINHQGKLVSLNDSDRVDISRVYHCDGLLLCIAKNYSRFVVWNPYSCKTLWLQPRSPHPRLDWYTYAIGYEKRKSCR
NYKVLRFVDLAETEFVKYEIYELKSNSLRVLDVTSDWKIEIYARGVSLKGNTYWFATDKFPEISNNVRHSVDFLICFNFT
SERFGPRLPLPFFSLNGDTVSLSSVREEQLAVLFQRGDNLKMEIWVTTKIEPEVVLWSKLFLAVDMQPLTDFPFLYTDAS
FIIDEEKKVVVVFDKDKDVMNTTRNTAYIIGEDGYYKEVDLGKSTDEFQYPLMCSYVPSSAEIKQGNKRKKNV*

DNA
ATGATGTCCGATCTTCCAAGTGATTTGGCAGAGGAGGTACTGTCTAGGCTTCCAGTGACATCTCTAAGAGGGTTCCGAGC
TGCTTGCAAAAAATGGAACACTTTGTCCAAAGAGCGGAGCTTTACAAGGAAACACCTTGCTCAAGCAAAAGCAGCGGCAG
CAAGGGAGTTTATGGTGGTCATGGTGATGAATTCTCGGGTTTATTTGATGGGCATCAATCTCCATGGAGTTCACGAGAGC
GTTGACCCATCTATAAACCATCAAGGTAAACTCGTTAGCCTAAACGATTCAGATCGGGTCGATATATCTAGAGTATATCA
CTGCGACGGTTTACTGTTATGCATCGCGAAAAACTACTCTAGGTTCGTGGTTTGGAATCCGTACTCGTGCAAAACTTTGT
GGCTCCAACCCAGAAGTCCCCACCCTAGATTGGACTGGTATACATATGCTATAGGATACGAGAAGCGCAAATCATGCCGG
AACTACAAAGTTTTGAGATTCGTTGATCTTGCCGAAACAGAATTTGTTAAGTACGAAATCTACGAGTTAAAGTCTAATTC
ATTGAGGGTTCTTGATGTCACTTCCGACTGGAAAATAGAGATCTATGCACGTGGTGTCTCTCTTAAGGGAAATACTTATT
GGTTTGCTACAGACAAGTTTCCAGAAATCAGCAATAATGTTAGACATAGTGTTGATTTCTTGATCTGTTTTAATTTTACA
TCGGAGAGATTTGGGCCGCGTCTTCCTTTGCCGTTTTTCTCTCTGAATGGAGATACTGTGAGTCTTTCTAGTGTTAGAGA
AGAGCAACTTGCTGTGTTATTTCAACGCGGTGACAACTTAAAGATGGAGATTTGGGTTACGACTAAGATTGAACCTGAAG
TGGTGTTGTGGAGCAAGTTGTTCTTAGCAGTGGATATGCAACCACTCACTGATTTTCCATTTTTATATACAGATGCAAGT
TTCATCATTGACGAAGAGAAGAAAGTTGTTGTAGTGTTTGATAAAGACAAAGATGTAATGAATACCACTCGCAACACAGC
TTACATCATTGGAGAGGATGGATATTACAAAGAGGTGGATCTCGGAAAATCTACTGATGAATTTCAATATCCACTTATGT
GCTCGTATGTTCCAAGCTCAGCGGAAATCAAGCAAGGAAACAAAAGGAAGAAAAATGTTTAA