Details for Lyrate rockcress Locus 16055019

Position : sca3 ( 5`- 7806545 .. 7809036 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16055019

Protein [Map View]
METPLPSLSQLTPNPTPAAAVSSAIPAAVKSVAVQQPIDGSPRAVAIDTGGHPEPLPAVPGAKLRLMCSFGGHIMPRPHD
KSLTYSGGETRMVVVDRRASLSSLRSRLSSMLLNGRSFTLKYQLPSEDLDSLVTITTDEDLENMIEEYDRATSSATATAT
QRLRLFLFANKLETAATMGSLLDGAKSDTWFVDALNQSGLLPRGLSDSAAVNNSLVNLDEASGGETEIQNLETNVGGENN
KRADLVANGVISHQEMHMSSMPDSPMMEAAGSSIGSSSSSPSTSNLPPIRVRVSEDQRIEEQLAQMTFSNMQTQRQFDDG
ASLMANRPMMIPSGAMNDAATMAYNNAPSDGAAATSNGQVSPDDDRSDSGVSTGYRKPPLPMQPVAIPPRTIGGYGLTSP
DSVASFLVSSSISLACLEFVVVFAPLLFYDLYMWFVLHSEFLMVGDTSISSANSFSKPMYYQDQPPALPRAPPVTQPETT
SVQSSQVLPQTENTSAQTNSHVLSQPGTYTTMDQQQHQPLAQQPFLHQGVQYIPHPSQYIPVYSHQQQNYPVYVMSVPQS
QQYIPAGTPPLYPNSKPATNSRPEAAQNVYRAAPPQVIQLQQQHQYMGYAGAPQHSTNANANYGTGAPQHSTNANANYGV
PYEYTNSPNETVYYHTQPPAANTAIPLASPYQSMTPAAAAAALADMSKQMALDGGKQQQHMAASQPL*

DNA
ATGGAGACCCCACTCCCTTCTTTATCGCAGCTAACCCCAAATCCTACTCCCGCCGCCGCCGTCTCTTCCGCTATTCCGGC
GGCAGTCAAGAGCGTAGCCGTTCAGCAACCGATTGATGGATCTCCACGCGCCGTTGCTATTGATACCGGAGGTCATCCGG
AGCCACTTCCGGCTGTTCCCGGCGCTAAGCTTCGTCTTATGTGTAGTTTTGGTGGCCACATCATGCCTCGTCCACACGAC
AAATCGTTGACGTACTCCGGCGGCGAGACTCGTATGGTCGTTGTTGATCGACGTGCGTCACTGTCTTCGCTCCGATCTCG
TCTCTCCAGTATGCTTCTCAACGGCCGGTCCTTCACTCTCAAGTATCAGCTCCCTAGCGAAGATCTCGATTCACTCGTCA
CCATCACTACCGATGAAGATCTGGAGAATATGATTGAGGAATACGATCGCGCGACTTCTTCAGCGACGGCGACTGCTACG
CAACGGCTCCGGTTGTTTCTTTTCGCTAATAAGCTCGAGACCGCCGCTACTATGGGGTCTCTGCTTGACGGCGCGAAATC
CGACACATGGTTCGTCGATGCTCTGAATCAATCTGGTTTGCTTCCTCGTGGTTTATCAGATTCCGCCGCCGTGAATAACT
CCTTGGTGAATCTCGACGAAGCTAGCGGCGGAGAGACCGAGATCCAAAACCTAGAAACTAATGTTGGTGGCGAGAACAAT
AAGCGGGCGGATTTGGTTGCTAACGGTGTGATTTCGCATCAGGAGATGCATATGAGCTCGATGCCTGATTCGCCAATGAT
GGAAGCCGCTGGCTCTTCGATAGGATCTTCTTCTTCTTCTCCTTCCACATCCAATTTGCCACCGATTCGCGTTAGAGTCA
GTGAAGACCAGAGGATAGAGGAACAATTGGCACAGATGACCTTCTCAAATATGCAAACTCAGAGGCAATTTGATGATGGC
GCAAGCTTGATGGCAAATCGGCCAATGATGATTCCGTCTGGTGCCATGAACGATGCTGCTACGATGGCGTATAACAACGC
ACCTAGTGATGGTGCGGCTGCTACAAGCAATGGCCAGGTTTCACCGGATGACGATCGATCCGATTCAGGTGTATCAACTG
GCTACAGGAAGCCACCTTTGCCGATGCAACCAGTAGCGATCCCACCTAGAACTATTGGAGGGTATGGCTTGACATCCCCT
GATTCCGTTGCAAGCTTCTTGGTTTCTTCATCAATTTCTTTAGCTTGCCTTGAATTTGTGGTTGTCTTTGCACCGTTGCT
GTTCTATGATCTTTACATGTGGTTTGTATTACATTCTGAATTTCTGATGGTAGGTGATACTAGTATTTCTTCTGCTAATT
CATTTTCAAAGCCGATGTACTACCAAGACCAACCTCCAGCTCTGCCAAGAGCTCCTCCAGTGACGCAGCCTGAAACCACA
TCAGTCCAAAGCTCTCAGGTCTTACCTCAGACTGAAAACACTTCAGCCCAAACCAACTCCCACGTCCTATCTCAACCAGG
TACATATACAACTATGGATCAACAACAACACCAACCTCTGGCTCAACAACCTTTCTTACACCAAGGCGTTCAGTATATCC
CTCATCCATCACAATACATCCCTGTTTACTCTCACCAGCAACAAAACTACCCTGTTTACGTGATGTCTGTCCCGCAATCT
CAGCAGTATATCCCAGCAGGAACTCCCCCACTCTACCCAAACTCAAAACCTGCCACAAACTCGAGGCCTGAAGCTGCCCA
GAACGTTTACCGTGCCGCTCCCCCTCAGGTTATTCAGCTTCAGCAACAGCATCAGTACATGGGTTACGCTGGAGCTCCTC
AACATAGCACAAACGCAAACGCCAATTACGGTACTGGAGCTCCTCAACATAGCACAAACGCAAACGCCAACTACGGTGTA
CCCTATGAATACACAAACTCCCCAAACGAGACAGTGTATTACCACACACAACCTCCTGCTGCCAACACTGCCATTCCATT
AGCGTCTCCATACCAAAGCATGACACCAGCAGCAGCCGCAGCAGCTCTAGCCGATATGTCCAAGCAAATGGCTCTTGACG
GCGGCAAACAGCAACAACATATGGCTGCGTCTCAGCCGCTTTAA