Details for Lyrate rockcress Locus 16054791

Position : sca1 ( 5`- 29082718 .. 29083037 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16054791

Protein [Map View]
MTQFLFIYNPITGQYVTLPKVTREVHASINYFAIGHYYVHRYLKGICVNGVLYYAAASSMQPVIVCFDVRSEKFDFITCF
RGWRET*

DNA
ATGACACAGTTTTTATTTATTTATAATCCCATCACAGGGCAGTATGTAACCTTACCCAAAGTGACAAGGGAAGTACATGC
GTCAATAAACTATTTCGCGATCGGACATTATTATGTTCACCGTTATCTTAAGGGGATATGCGTCAATGGTGTTTTGTATT
ATGCTGCAGCAAGCTCTATGCAACCTGTGATCGTTTGCTTTGACGTTAGGTCTGAGAAATTTGATTTTATTACTTGTTTT
AGAGGATGGCGAGAAACATAA