Details for Lyrate rockcress Locus 16054761

Position : sca3 ( 5`- 12046014 .. 12048843 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_342636 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16054761

Protein [Map View]
MKSLHVAANGEDLAEDCGILAGDADDTALMDGMDEVGREIWLDDHGGDHNHVHVHSHEDDDLIVHHDPSIFYGDLPTLPD
FPCMSSSSSSSTSPAPVNAIVSSASSSSAASSSTSSAASWAILRSDGEDPTPNQNQYASGNCDDSSGALQSTGSMEIPLD
NSQGFGCGEGGGDCIDMMETFGYMDLLDSNEFFDTSAIFSQDDDTQNPNLMDQTLERQQDQVVVPMLEKNSGGDMQMMNS
SLEQDDDLATVFLEWLKNNKETVSAEDLRKVKIKKATIESAARRLGGGKEAMKQLLKLILEWVQTNHLQRRRTTTNNNNN
FSYQQSFQQDPFQNPNPNNNNLIPPSDQTCFSPSTWVPPPPPQQAFVSDPGFGYMPAPNYPPPGEFLPLLESPPSWPPPP
PPPQSGPMPHQQFAMPPNTQYNQFGEPTGFTGYNMNPYQYPYVPAGQVRDQRLLRLCSSATKEARKKRMARQRRFLSHHH
RHNNNNNNNQQNQTQIGETCAAVAPQLNPVATTATGGTWMYWPNVPAAPPPQLPPAMETQLPTMDRAGSLAAMPRQQAVP
DRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYL
LENTGDFVKTNGLQEGDFIVIYSDVKCGKYLIRGVKVRQPTGQKPEAPPSSAAATKRQNKSQRNINNNSPSANVVVASPT
SQTVK*

DNA
ATGAAAAGCTTGCATGTGGCGGCAAACGGCGAAGATCTGGCTGAGGATTGTGGAATACTAGCCGGAGACGCTGATGATAC
TGCTTTGATGGATGGAATGGATGAAGTTGGTAGAGAGATCTGGCTAGATGACCATGGAGGAGATCATAATCATGTTCATG
TTCATAGTCATGAAGATGATGATTTGATTGTTCATCATGACCCTTCAATATTCTATGGAGATCTCCCAACGCTTCCTGAT
TTCCCATGCATGTCGTCATCATCATCTTCTTCAACATCTCCAGCTCCTGTCAACGCAATCGTCTCCTCAGCATCTTCCTC
TTCGGCAGCTTCTTCCTCCACTTCCTCAGCTGCTTCTTGGGCCATATTGAGATCAGATGGAGAAGATCCGACTCCAAACC
AAAACCAATACGCATCAGGTAACTGTGACGACTCTTCTGGCGCATTGCAATCCACAGGTTCCATGGAGATTCCATTAGAC
AATAGTCAAGGCTTCGGTTGCGGTGAAGGCGGTGGTGATTGCATTGATATGATGGAGACTTTCGGGTATATGGATCTACT
TGATAGCAACGAGTTCTTTGATACCTCAGCTATCTTCAGCCAAGACGACGACACGCAAAACCCTAACTTGATGGACCAAA
CACTCGAGAGACAACAAGACCAGGTTGTTGTTCCGATGTTGGAGAAAAATAGTGGTGGAGACATGCAAATGATGAATTCT
TCCTTGGAACAAGACGATGATCTAGCTACTGTGTTCTTAGAGTGGCTAAAGAACAACAAGGAGACTGTGTCGGCTGAGGA
TTTGAGGAAAGTGAAGATAAAGAAAGCAACGATAGAGTCAGCGGCGAGAAGGCTTGGCGGTGGTAAAGAAGCGATGAAGC
AGCTTTTGAAGCTGATTCTTGAATGGGTCCAAACTAATCACTTACAAAGAAGACGCACCACCACCAACAACAACAACAAC
TTCTCTTATCAACAATCATTCCAACAAGATCCATTTCAAAACCCTAACCCTAATAACAACAACCTAATCCCACCGTCTGA
CCAAACCTGTTTCTCACCTTCTACATGGGTTCCTCCACCACCACCACAACAAGCTTTTGTCTCCGACCCGGGTTTTGGAT
ACATGCCTGCTCCAAACTATCCACCACCGGGAGAGTTCCTTCCTTTACTTGAATCTCCACCATCATGGCCACCACCACCA
CCACCACCGCAGTCTGGTCCTATGCCACATCAACAATTCGCTATGCCACCAAACACGCAGTATAATCAATTTGGAGAGCC
AACAGGTTTCACAGGATACAACATGAATCCGTATCAATATCCTTATGTTCCTGCAGGACAGGTGAGAGATCAGAGATTGC
TACGTTTGTGTTCCTCAGCAACTAAAGAGGCAAGAAAAAAACGGATGGCTAGACAGCGGAGGTTCTTGTCTCACCACCAC
AGACATAACAACAACAACAACAATAATCAGCAGAACCAGACCCAAATCGGAGAGACCTGTGCCGCCGTGGCTCCACAACT
TAACCCTGTGGCCACAACCGCCACCGGAGGGACCTGGATGTATTGGCCTAATGTCCCGGCTGCGCCGCCGCCTCAATTAC
CACCGGCGATGGAGACTCAGTTACCAACCATGGACCGAGCTGGCTCTCTTGCTGCTATGCCACGTCAGCAGGCGGTACCA
GATCGTCGGCAGGGATGGAAACCAGAAAAGAACTTGCGGTTTCTCTTGCAGAAAGTCTTGAAGCAAAGCGACGTGGGTAA
CCTCGGAAGGATCGTCTTACCAAAAAAAGAAGCTGAGACACACTTGCCGGAGCTAGAGGCAAGAGATGGCATCTCTCTGG
CCATGGAAGACATCGGAACCTCTCGTGTTTGGAACATGCGCTACAGGTTTTGGCCTAACAACAAAAGCAGGATGTATCTC
CTCGAGAACACCGGTGATTTTGTGAAAACTAATGGGCTCCAAGAAGGTGATTTCATAGTCATATACTCCGACGTCAAATG
TGGCAAATATTTGATACGTGGTGTTAAAGTAAGACAACCGACGGGACAAAAGCCGGAGGCTCCGCCTTCATCAGCAGCCG
CCACGAAGAGACAAAACAAGTCGCAGAGGAACATTAACAATAACTCTCCGTCTGCGAATGTGGTGGTCGCTTCACCAACT
TCTCAAACTGTTAAATGA