Details for Lyrate rockcress Locus 16054746

Position : sca3 ( 5`- 2309692 .. 2309330 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16054746

Protein [Map View]
MPVSYPEVTVVEEDNEHNERDNDNTIKKKKKKKEAKGNRFLIPFVSKAKKRIVSKITRKPLSPASSGFWKRVCFCGTEPT
NSLEWSSSSNPDPEDVNFTLRVLLQTNDFFSKDSNPHLCL*

DNA
ATGCCTGTGAGTTACCCTGAGGTTACGGTGGTTGAAGAAGACAATGAACATAACGAGAGAGATAATGATAACACCATTAA
GAAGAAGAAGAAGAAAAAGGAAGCTAAAGGGAATCGATTCTTGATCCCTTTCGTCTCAAAAGCTAAGAAACGAATCGTAT
CTAAGATCACAAGGAAACCCTTATCTCCTGCTTCTTCTGGGTTTTGGAAAAGAGTTTGCTTTTGTGGAACTGAACCTACC
AATTCATTGGAATGGTCATCTTCTTCCAATCCTGACCCTGAAGATGTCAACTTTACGCTTAGGGTTCTGCTACAGACCAA
TGATTTCTTCTCCAAGGACTCTAATCCACATCTCTGTTTGTAA