Details for Lyrate rockcress Locus 16054715

Position : sca3 ( 5`- 8561053 .. 8560562 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16054715

Protein [Map View]
MDNSKVEVDNDHASGSKGSSVGENSLDSEEYDDMSDDSTEEESDENSASYGKILMDYLMSEMIADMYDDFTDDLFDILAA
RIPSLSALRTCNKQPSDDKTSTVFYSMNVLNNLTGVRMWSPLYVASLTHIQAHVTHREAFLAFSDPENKICYLEHKTSKK
RDE*

DNA
ATGGATAATTCTAAAGTGGAAGTTGACAATGATCATGCAAGCGGATCGAAAGGATCAAGCGTTGGGGAAAACAGTTTGGA
TTCTGAAGAGTATGATGATATGTCTGATGATTCAACAGAGGAGGAGTCTGATGAGAATTCTGCGAGCTATGGAAAAATCC
TTATGGATTATCTTATGTCTGAAATGATTGCTGATATGTATGATGATTTTACAGACGACCTGTTCGATATTCTTGCAGCT
AGAATCCCTTCACTTAGCGCACTACGAACCTGCAATAAGCAGCCATCAGATGACAAGACTAGTACGGTGTTTTATTCAAT
GAATGTCCTCAATAATCTTACTGGTGTGAGGATGTGGTCGCCTTTATACGTTGCATCGTTGACTCATATTCAGGCTCATG
TAACTCACAGAGAGGCATTCTTAGCATTTTCTGATCCCGAGAATAAGATTTGCTACTTAGAGCACAAGACTAGCAAAAAG
AGAGATGAATGA