Details for Lyrate rockcress Locus 16054686

Position : sca3 ( 5`- 3695874 .. 3698243 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16054686

Protein [Map View]
MAPNDPKKAGGGSGFFASLASSISNLGSAMTKSVNGLVPYEGLEVINPEGSTDDAEEEASRGRWKQEDRDGYWKMMQKYI
GSDVTSMVTLPVIIFEPMTMLQKMAELMEYSHLLDMADETEDPYMRMVYASSWAISVYYAFQRTWKPFNPILGETYEMAN
YNGVNFISEQVSHHPPMSAGHAENEHFTYDCTSKLKTKFLGNSIDVYPVGRTRVTLKRDGVVLDLVPPLTKVHNLIFGRT
WVDSPGEMIMTNLTTGDKVVLYFQPCGWFGSGRYEVDGYVYNASEEPKILMTGKWNESMSYQLCDGEGEPLPGTELKEVW
KLADVPKDDKYQYTHFAHKINSFDTAPKKLLPSDSRLRPDRYALEMGDMSKSGNEKSSMEERQRAEKRTREEKGQGFTPK
WFDVTDEVTATPWGDLEVYQFNGKYLEHRAAADNSEDNTDPKSIQFNPWQFQDLST*

DNA
ATGGCTCCTAATGATCCTAAAAAAGCCGGTGGCGGAAGTGGTTTCTTCGCTTCTCTTGCTTCTTCGATCTCCAATTTGGG
ATCTGCTATGACCAAATCAGTTAATGGTTTGGTTCCCTATGAGGGACTTGAAGTTATCAATCCCGAAGGAAGTACAGATG
ATGCAGAGGAGGAAGCAAGCAGAGGAAGATGGAAGCAAGAGGATCGAGATGGGTATTGGAAGATGATGCAGAAGTACATA
GGATCTGATGTTACATCAATGGTGACCCTTCCTGTGATTATTTTTGAACCAATGACAATGCTCCAGAAAATGGCAGAGTT
GATGGAATACTCGCATCTCCTAGACATGGCAGACGAAACTGAGGACCCTTATATGCGCATGGTGTATGCATCATCATGGG
CTATATCCGTGTATTATGCTTTCCAACGTACCTGGAAACCATTCAATCCAATCCTGGGTGAGACTTATGAGATGGCTAAT
TACAATGGTGTTAACTTCATATCTGAACAGGTCAGCCATCACCCACCAATGAGTGCTGGTCATGCTGAAAATGAGCATTT
TACGTATGATTGTACTTCAAAACTGAAAACAAAATTTCTGGGAAATTCCATTGACGTTTACCCAGTAGGAAGGACACGGG
TGACACTTAAAAGAGATGGAGTTGTTCTTGACTTGGTACCTCCTCTGACCAAAGTTCACAACCTAATCTTTGGACGAACT
TGGGTCGATTCGCCTGGGGAAATGATCATGACAAACCTGACCACCGGTGACAAAGTTGTGCTTTACTTTCAACCATGTGG
CTGGTTCGGATCTGGTCGATATGAAGTGGATGGATATGTCTATAACGCCTCTGAGGAGCCTAAGATACTCATGACTGGCA
AATGGAACGAGTCCATGAGTTATCAGCTGTGTGACGGTGAAGGTGAACCTCTCCCAGGCACCGAACTGAAAGAGGTATGG
AAACTCGCTGATGTTCCAAAGGATGACAAATACCAATACACACACTTTGCGCACAAGATCAATAGCTTCGACACTGCCCC
GAAAAAGCTGTTGCCATCTGATTCACGGTTACGACCTGATAGATACGCACTTGAGATGGGCGACATGTCCAAATCAGGCA
ATGAGAAAAGCAGCATGGAAGAGAGACAGAGAGCTGAAAAGAGAACCCGCGAAGAGAAAGGCCAAGGCTTTACTCCTAAA
TGGTTCGATGTAACGGATGAAGTCACTGCTACACCATGGGGTGATCTCGAAGTTTACCAATTCAATGGAAAGTACTTGGA
GCATCGTGCAGCTGCCGATAACTCTGAAGATAACACTGACCCTAAGTCGATCCAATTCAACCCATGGCAATTCCAAGATC
TGTCTACTTAA