Details for Lyrate rockcress Locus 16054666

Position : sca1 ( 5`- 7777589 .. 7778062 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_889273 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16054666

Protein [Map View]
MEDQIRQLKDIFDRFDMDADGSLTILELAALLRSLGLKPSGDQIHVLLASMDANGNGFVEFDELVGTILPDLNEEILINS
EQLLEIFKSFDRDGNGFISAAELAGAMAKMGQPLTYKELTEMIKEADTNGDGVISFGEFASIMAKSAVDYFGLKINS*

DNA
ATGGAGGATCAGATAAGGCAATTAAAAGACATTTTTGACCGGTTTGACATGGACGCAGACGGAAGCTTAACAATCTTAGA
ACTCGCGGCGCTTCTCCGGTCACTCGGCCTCAAACCTTCAGGCGACCAAATCCACGTATTGCTAGCTAGCATGGACGCAA
ACGGCAATGGTTTTGTCGAATTCGATGAGCTCGTTGGTACAATTCTTCCTGATCTGAACGAAGAGATCCTAATCAATTCC
GAGCAATTACTCGAGATTTTCAAATCATTCGATAGAGACGGTAACGGGTTCATCAGCGCAGCTGAGCTTGCTGGAGCGAT
GGCGAAGATGGGTCAACCATTGACATATAAAGAACTAACGGAGATGATCAAAGAAGCAGATACAAATGGTGACGGTGTTA
TAAGCTTTGGAGAATTTGCTTCCATTATGGCAAAATCTGCTGTTGATTATTTTGGATTAAAAATTAATTCATGA