Details for Lyrate rockcress Locus 16054653

Position : sca3 ( 5`- 1748698 .. 1749169 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16054653

Protein [Map View]
MKSFLVAFLIVLVFFSAELKIGNGFEIPVVPEPTGKWCGYSVPMKPCTNDECIKQCIAENTHGWLMTTGKCTSIPSLKDC
YCIHQCP*

DNA
ATGAAGAGTTTTTTGGTAGCGTTTCTTATTGTGCTCGTCTTCTTCTCTGCTGAATTGAAAATAGGAAATGGATTCGAAAT
ACCAGTAGTACCAGAACCAACAGGAAAATGGTGTGGATATTCAGTGCCGATGAAACCATGCACAAACGATGAATGCATTA
AACAATGTATTGCGGAAAATACGCATGGTTGGCTGATGACTACTGGCAAGTGCACATCTATCCCAAGCTTAAAAGATTGT
TACTGTATCCATCAGTGTCCCTAA