Details for Lyrate rockcress Locus 16054618

Position : sca3 ( 5`- 4906220 .. 4904546 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16054618

Protein [Map View]
METQIHQLEQEAYTAVLRAFKAQSDAISWEKESLITELRKELGVSDDEHRELLSRVNKDDTIQRIRDWRQGGGSQNTRHA
TIQPFDVLPSPTFSAGRKKQKTFQSYHPSIGATGNKSFNSRVVSGGISGNESAEALIGRKVWTKWPEDNHFYEAIITQYN
ADDGRHALVYDIHAANETWEWVDLKEIPPEDIRWDGEESGVALNIGHGSGSFRGNRRSQIHGGRGRGPRIHQPRREILPP
PTQQNGGGGRRTSSDDIELFNTDSLVKEVERVFDSTHPDPLELDKAKKMLKRIITTSVLADTSDGEMGNNNKIMLCLVCD
LRINFIYP*

DNA
ATGGAGACGCAAATTCATCAACTTGAGCAGGAAGCATATACCGCTGTTTTAAGGGCTTTTAAAGCGCAGTCTGATGCGAT
TTCTTGGGAAAAAGAAAGCTTGATAACCGAATTGCGTAAAGAATTGGGAGTATCTGATGATGAACATCGAGAGCTTCTGA
GTAGGGTCAATAAGGATGATACTATCCAGAGGATAAGAGATTGGAGACAGGGAGGCGGAAGCCAAAATACTAGACATGCA
ACTATTCAGCCTTTTGATGTTCTTCCTAGTCCCACTTTCTCAGCTGGCCGAAAGAAACAGAAAACATTCCAATCTTATCA
TCCATCAATTGGTGCGACTGGAAATAAGTCATTCAATAGTCGTGTGGTATCTGGTGGCATATCAGGAAATGAATCTGCTG
AAGCTTTGATCGGAAGAAAAGTGTGGACAAAATGGCCTGAAGATAACCACTTTTATGAAGCAATTATAACCCAGTACAAT
GCAGATGATGGTCGGCATGCTTTGGTGTATGATATACATGCAGCTAATGAAACGTGGGAATGGGTTGATCTCAAGGAGAT
ACCACCGGAAGATATAAGGTGGGATGGGGAGGAGAGTGGGGTAGCTTTAAACATTGGACATGGAAGTGGATCATTCCGTG
GCAATCGAAGAAGCCAAATCCATGGTGGTAGAGGGAGAGGGCCAAGAATTCATCAACCAAGAAGAGAAATCTTACCACCA
CCAACACAACAGAATGGTGGTGGTGGTCGGAGAACTTCCTCTGATGATATTGAATTGTTCAACACAGACTCACTTGTGAA
GGAGGTGGAGAGAGTTTTCGATTCAACTCATCCTGATCCGCTCGAGCTCGATAAGGCCAAGAAAATGCTCAAGAGAATAA
TAACAACAAGTGTGCTTGCTGATACTTCTGATGGCGAAATGGGTAATAATAACAAAATCATGCTATGTTTAGTTTGTGAT
CTCAGAATAAATTTTATTTACCCTTGA