Details for Lyrate rockcress Locus 16054557

Position : sca3 ( 5`- 9567508 .. 9565679 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16054557

Protein [Map View]
MNQSNLATPSLSLTVTLIPKHPIRHLTAPIHNRNRNFANPKLFFPLRLNETPSSLTSKRVFVVRATVDGDGKTSNWVNRL
PIPGLGAENVFRLISSATGSPIGQFISSPVTFLHSVDPRIKLVWLLTLVVLPARANIVVRLGLVVCTALLSILVLPRQVW
MDQLARVSLLSGILFITLGLGSDGAPPMLQSRTPPSSITSLPNLPMSLSGYSYMLLKLGPLQFTRKGLSVGSTAACLTFI
IFQSASICLATTTPEQLALALRWFLFPLTYIGVPVGEIILTLLLSLRFINLVFDEVRSVSLGIVSRRVNWQQLTVLETLD
IFASFIRRIFKNIFRHAEQISQAMIVRGFRGESSSHKIYFFSGSSNKFADFASVLSLIGVISTALLSEYFLV*

DNA
ATGAATCAATCCAATCTTGCAACACCAAGTCTCTCCCTCACCGTAACCCTAATCCCCAAACACCCAATTCGTCATCTCAC
AGCTCCAATTCATAACCGGAACCGGAATTTTGCAAACCCTAAGCTTTTCTTCCCGCTCCGGCTTAATGAGACTCCGTCCT
CTCTCACCTCGAAAAGGGTTTTCGTGGTTAGAGCCACCGTCGACGGAGACGGAAAAACCAGTAATTGGGTGAACCGGTTA
CCAATTCCAGGACTCGGAGCCGAAAATGTCTTTAGATTGATTTCAAGCGCGACGGGAAGTCCCATTGGACAATTCATATC
GTCCCCTGTTACATTTCTCCATTCGGTGGATCCGAGAATCAAATTGGTATGGCTATTAACTCTAGTTGTTCTTCCAGCAA
GAGCAAATATAGTTGTGCGTTTAGGACTTGTTGTATGCACAGCTCTTTTGTCAATCCTTGTCCTCCCTAGACAAGTATGG
ATGGATCAATTGGCGAGAGTGTCGCTTCTTTCGGGAATTCTCTTCATAACATTGGGGCTAGGTTCAGATGGTGCACCTCC
AATGCTTCAATCAAGAACCCCACCTTCTTCAATCACAAGCTTGCCTAATCTTCCCATGTCTTTGAGCGGTTATTCGTACA
TGTTACTTAAGCTTGGTCCGTTGCAATTCACAAGGAAAGGTTTGTCTGTTGGAAGTACAGCCGCATGCTTAACCTTTATT
ATCTTCCAAAGTGCTAGTATTTGCCTTGCAACCACAACACCAGAACAACTTGCACTAGCTCTACGTTGGTTCTTGTTCCC
GTTGACATATATTGGTGTTCCAGTCGGTGAAATTATCCTCACGCTACTGCTTTCACTGAGATTCATTAATTTGGTTTTCG
ATGAGGTCCGAAGTGTTTCATTGGGAATTGTATCCCGAAGAGTAAACTGGCAGCAGCTTACTGTTCTGGAGACACTTGAT
ATTTTCGCGTCATTCATACGCCGCATTTTCAAGAATATATTTCGACATGCCGAGCAAATATCACAGGCCATGATTGTTAG
AGGCTTCAGAGGAGAGAGCAGTAGCCACAAGATCTACTTCTTCTCTGGCTCATCGAATAAGTTTGCAGATTTTGCATCAG
TCTTGTCTTTAATCGGTGTAATATCAACCGCGCTCTTGTCTGAATACTTTCTTGTCTAA