Details for Lyrate rockcress Locus 16054546

Position : sca3 ( 5`- 7535275 .. 7536394 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16054546

Protein [Map View]
MSSVALPAMSCRSSGEQVNEIRVCTNRTCRRQGSFQILETLTALAPPELRVTPCACLGRCGSGPNLVALPQGLILRHCAT
PSRAAEILFSLCGDGREASSSSAVTDALTALALTNNALYQIDAGNFSEAEALLTQALELKPYGGLHRIFKHRSVAKLGML
DYSGALEDISRALALAPNYYEPYICQGDVYVAKGQYDLAEKSYLKCLEIDPSLRRSKPFKARIANLQKKVVEVDVT*

DNA
ATGTCTTCCGTCGCTTTGCCGGCGATGAGCTGCCGGAGCTCAGGAGAACAAGTGAATGAGATTCGCGTTTGTACTAATCG
CACCTGCCGGAGACAAGGCTCTTTCCAGATTCTCGAGACATTAACGGCTCTCGCACCTCCCGAACTCCGAGTCACTCCCT
GCGCTTGCCTCGGCCGATGCGGCTCCGGTCCAAACCTCGTGGCTCTTCCTCAAGGTCTCATCCTCCGTCACTGCGCCACC
CCTTCTCGAGCTGCTGAAATTTTGTTCAGCCTCTGTGGTGACGGTCGTGAAGCTTCTTCCTCCTCCGCCGTCACGGACGC
TCTCACCGCTTTAGCGCTAACGAACAATGCTCTCTATCAAATCGATGCGGGAAACTTCTCTGAAGCCGAAGCACTTCTCA
CTCAGGCTTTAGAGCTGAAACCCTACGGTGGCTTGCATAGAATCTTCAAACACAGATCAGTAGCAAAACTGGGAATGCTT
GATTACTCTGGGGCTCTTGAAGATATAAGCCGTGCTCTAGCATTAGCTCCTAACTATTATGAGCCATATATATGCCAAGG
GGATGTCTACGTAGCAAAGGGTCAATATGATCTTGCAGAGAAGTCATACTTGAAATGTCTAGAGATAGATCCTTCTCTTC
GCAGATCGAAACCATTCAAGGCCCGGATTGCAAATCTTCAAAAGAAAGTTGTTGAAGTAGATGTGACATAG