Details for Lyrate rockcress Locus 16054464

Position : sca5 ( 5`- 17908309 .. 17909010 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16054464

Protein [Map View]
MAASARICCGGGSACAVRCDRRTLNLNSRSSCVVPVTNRRNRCEIGKVSMSMDDLNPPSAAVKIERIGERKRGGSVVSRE
KLDVWLRDSVVEIVKNLRESPLLMHLYAEANGGLTTTATNPEAEDWPEMEGKWDRGEERTPEGVIFVEKLADGDVEDDDD
HDGGACGEDTSAWGIVAQGRGTDSGPVCYLLKTTRVGSGMGTVCTHFCLVKVKSFRETAMSQLNNSWLVQTGQ*

DNA
ATGGCGGCGTCTGCGAGGATTTGTTGCGGAGGAGGAAGTGCATGTGCTGTTCGTTGTGATCGTCGTACGCTGAATTTGAA
TTCTCGATCGTCGTGTGTTGTTCCAGTGACGAATCGACGGAATCGATGTGAGATCGGGAAGGTTTCCATGTCGATGGATG
ATTTGAACCCACCGTCTGCGGCGGTGAAGATCGAACGGATCGGTGAAAGGAAACGTGGTGGATCTGTTGTGTCGAGGGAG
AAGCTTGATGTGTGGTTGAGAGATTCGGTGGTTGAGATTGTTAAGAATCTTAGGGAATCTCCGTTATTGATGCATTTATA
CGCGGAGGCGAATGGTGGTTTGACGACGACGGCAACGAATCCGGAGGCGGAGGATTGGCCGGAGATGGAAGGAAAGTGGG
ATAGAGGAGAAGAGAGGACGCCGGAAGGAGTTATATTCGTGGAGAAGCTCGCTGACGGTGACGTAGAGGATGATGATGAT
CACGATGGTGGCGCGTGTGGAGAAGATACTAGCGCGTGGGGGATTGTGGCGCAAGGAAGAGGAACGGATAGTGGGCCGGT
TTGTTATCTATTGAAAACAACCCGGGTCGGGTCGGGTATGGGTACGGTTTGTACCCATTTCTGTCTGGTTAAGGTCAAGA
GTTTTAGGGAAACGGCTATGTCACAGTTGAATAACTCATGGTTGGTGCAGACTGGTCAATGA