Details for Lyrate rockcress Locus 16054460

Position : sca3 ( 5`- 8725560 .. 8728456 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479518 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16054460

Protein [Map View]
MADIFPPLTAAQVDAKIKVDEKVDYSNLPCPVPYEELHREALMSLRSDNFEGLRFDFTRALNQKFSLSHSVMMGPTEIPS
QSSETIKIPTAHYEFGANYYDPKLLLIGRVMTDGRLSARVKADLTEKLVVKANAQITNEQHQSQAMFNFDYMGSDYRAQL
QLGQSALIGATYIQSVTNHLSLGGEVFWAGVPRKSGIGYAARYETDKMVASAQVASTGAVVMNYVQKISDKVSLATDFMY
NYFSRDVTASVGYDYILRQARVRGKIDSNGVASALLEERLSMGLNFLLSAELDHKKKDYKFGFGLTVG*

DNA
ATGGCGGATATTTTCCCACCTCTTACGGCGGCACAAGTCGATGCAAAGATTAAAGTCGATGAGAAAGTCGATTATTCGAA
CCTCCCTTGTCCTGTTCCCTATGAGGAACTCCACCGTGAAGCTCTCATGTCTTTAAGGTCGGACAATTTTGAGGGTTTAC
GCTTTGACTTTACCAGGGCGCTGAATCAGAAGTTTTCTCTCAGTCATAGTGTGATGATGGGGCCAACCGAAATTCCCTCT
CAGTCATCTGAAACTATCAAAATTCCAACTGCCCATTATGAGTTTGGTGCCAATTATTATGACCCAAAGTTGTTGCTCAT
CGGAAGGGTAATGACTGATGGTAGACTAAGTGCGAGAGTGAAAGCAGATTTAACTGAGAAGTTAGTTGTGAAGGCGAATG
CTCAGATAACAAATGAGCAACATCAGTCACAAGCAATGTTCAACTTTGATTACATGGGATCAGACTACAGAGCTCAGCTT
CAACTTGGACAGAGTGCCCTAATTGGAGCAACTTATATCCAGAGTGTTACAAACCATTTATCCTTGGGTGGTGAAGTTTT
CTGGGCTGGTGTGCCTCGAAAATCGGGAATAGGCTATGCTGCTAGATACGAGACGGATAAAATGGTTGCTTCTGCACAAG
TTGCTAGCACGGGTGCCGTTGTTATGAACTATGTTCAGAAGATTTCAGATAAGGTTTCACTTGCCACTGACTTCATGTAC
AACTACTTTTCAAGAGATGTAACAGCTAGTGTGGGTTACGACTATATTCTTAGACAGGCTCGTGTGCGGGGAAAGATCGA
TTCCAACGGTGTTGCATCCGCTCTCCTTGAAGAAAGATTGAGTATGGGACTCAATTTTCTTCTTTCTGCAGAGCTGGATC
ATAAGAAGAAGGACTACAAGTTTGGTTTCGGATTAACAGTTGGTTAA