Details for Lyrate rockcress Locus 16054410

Position : sca3 ( 5`- 7831740 .. 7837760 -3` )
Annotation : [B2G] EMB2454 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16054410

Protein [Map View]
MATPLPDFETARGGGGVASSSTTVLTSSVSSSSSSRPLPVANSFSEDAEEISPILIFLFFHKAVCSELETLHRLALEFAT
GHHVDLRLLRERYRFLRSIYKHHCNAEDEVIFSALDIRVKNVAQTYSLEHKGESNLFDHLFELLNSATETDESYRRELAR
STGALQTSVSQHLAKEQKQVFPLLIEKFKYEEQAYIVWRFLCSIPVNMLAVFLPWISSSISVDESKEMQTCLKKIVPGEK
LLQQVIFTWLGGKSNTVASCRIEDSMFQCCLDSSSSMLPCKASREQCACEGSKIGKRKYPELTKFGSSDTQMHPVDEIKL
WHKSINKEMKEIADEARKIQLSGDFSDLSAFDERLQYIAEVCIFHSLAEDKIIFPAVDGEFSFSEEHDEEENQFNEFRCL
IENIKSAGASSTSAAEFYTKLCSHADQIMETIQRHFHNEEIQVLPLARKNFSLKRQQELLYQSLCIMPLRLIERVLPWLT
ASLTEDEAKNFLKNLQAGAPKSDVALVTLFSGWACKGRKAGECLSPNGNGLCPVKTLNNIKEVNLQSCNTCASVPCTSRS
TESCCQHQDKRPAKRTAVLSCEKKTTTHSSEVANGCKPSGNGRSCCVPDLGVNNNCLELGSLPAAKAMRSSSLNSAAPAL
NSSLFIWEMDSNSFGTGHAERPVATIFKFHKAISKDLEFLDVESGKLIDCDGTFIRQFIGRFHLLWGFYKAHSNAEDDIL
FPALESKETLHNVSHSYTLDHKQEEKLFGDIYSVLTELSILHEKLQSDSVMGDIAQTDTVQTDIDNSDCKKKYNELATKL
QGMCKSIKITLDQHIFLEELELWPLFDKHFSIQEQDKIVGRIIGTTGAEVLQSMLPWVTSALSEDEQNRMMDTWKQATKN
TMFDEWLNECWKGSPDSSSTETSKPSPQKDNDHQEILDQTGELFKPGWKDIFRMNQNELEAEIRKVYQDSTLDPRRKDYL
VQNWRTSRWIAAQQKLPKETETALNGEVELGCSPSFRDPEKQIYGCEHYKRNCKLRAACCDQLFTCRFCHDKVSDHSMDR
KLVTEMLCMRCLKVQPVGPICTTPSCDGFPMAKHYCSICKLFDDERAVYHCPFCNLCRVGEGLGIDFFHCMTCNCCLGMK
LVNHKCLEKSLETNCPICCEFLFTSSEAVRALPCGHYMHSACFQAYTCSHYTCPICGKSLGDMAVYFGMLDALLAAEELP
EEYKNRCQDILCNDCECKGTTRFHWLYHKCGSCGSYNTRVIKSETTPPDCSTSS*

DNA
ATGGCGACGCCGTTACCAGATTTTGAGACGGCGAGAGGCGGCGGAGGAGTGGCGTCTTCTTCAACCACGGTTCTTACGAG
TTCTGTGTCTTCCTCTTCTTCCTCTCGTCCGTTGCCTGTGGCGAATTCGTTCTCGGAAGACGCGGAAGAGATTTCTCCGA
TCCTGATTTTCTTGTTCTTTCATAAGGCAGTATGTAGTGAGCTTGAAACTCTTCATAGATTGGCGCTGGAGTTTGCTACT
GGTCACCATGTCGATCTCCGGCTGCTTCGTGAACGGTACCGGTTCTTGAGATCCATCTATAAGCATCACTGCAATGCCGA
AGACGAGGTGATATTTTCAGCTCTTGACATACGTGTGAAGAATGTAGCGCAAACATATTCTCTTGAACACAAGGGGGAAA
GCAATCTTTTCGATCATCTCTTTGAGCTGCTGAATTCTGCCACGGAAACTGATGAAAGTTACCGAAGGGAGTTGGCTCGT
TCTACTGGAGCACTTCAGACTTCTGTTAGCCAGCACTTGGCAAAAGAACAGAAACAGGTGTTCCCCTTACTTATTGAGAA
ATTCAAGTATGAGGAGCAAGCTTACATAGTCTGGCGGTTTCTCTGCAGTATTCCTGTGAATATGCTTGCTGTGTTCCTGC
CATGGATTTCTTCCTCCATTTCAGTAGATGAAAGCAAGGAGATGCAAACGTGCTTAAAGAAGATAGTTCCAGGCGAGAAG
CTCCTTCAGCAGGTTATTTTCACCTGGTTGGGAGGGAAAAGCAATACTGTGGCTTCGTGTCGCATTGAAGATTCTATGTT
TCAGTGCTGTCTAGATTCTTCTAGCAGCATGCTTCCTTGTAAAGCAAGTAGAGAACAGTGCGCATGTGAGGGGTCCAAGA
TTGGGAAGAGAAAGTACCCAGAGCTTACTAAGTTTGGTTCATCTGATACTCAGATGCACCCAGTTGATGAGATAAAGCTC
TGGCACAAGTCAATCAACAAGGAGATGAAAGAAATAGCCGATGAGGCTAGGAAGATTCAGCTATCTGGAGATTTTTCGGA
TTTATCTGCATTTGATGAACGCTTACAATATATTGCTGAAGTGTGCATCTTCCACAGTCTTGCAGAGGACAAGATCATAT
TTCCAGCAGTAGATGGGGAGTTTTCATTTTCTGAGGAGCACGATGAAGAAGAAAATCAGTTTAACGAGTTTCGATGCTTA
ATTGAAAATATCAAGAGTGCTGGAGCCTCTTCTACTTCCGCTGCTGAATTTTACACCAAGTTGTGCTCACATGCTGATCA
AATAATGGAAACTATTCAAAGACACTTCCACAACGAGGAAATTCAGGTGCTACCCCTTGCACGAAAGAACTTCAGCTTGA
AAAGACAACAAGAACTTCTCTACCAAAGCCTGTGTATAATGCCATTGAGACTAATTGAACGAGTTTTGCCATGGTTGACG
GCATCTTTAACAGAAGATGAAGCTAAGAATTTTCTGAAGAACTTGCAAGCTGGAGCACCTAAATCAGATGTTGCTCTCGT
TACTCTTTTCTCTGGTTGGGCATGCAAAGGACGCAAAGCCGGGGAATGCTTGTCTCCAAACGGGAATGGTTTATGCCCTG
TTAAAACACTAAACAACATTAAAGAAGTCAACCTTCAGTCATGTAATACTTGTGCGTCTGTTCCATGCACTAGTAGGAGT
ACAGAATCGTGTTGCCAGCATCAAGATAAAAGGCCAGCTAAGCGAACTGCTGTATTGTCTTGTGAAAAAAAAACCACCAC
GCACTCGTCAGAAGTTGCAAATGGGTGCAAGCCATCTGGAAATGGTAGGTCATGCTGTGTTCCGGATCTCGGAGTTAACA
ATAATTGTCTGGAACTTGGTTCTCTTCCAGCAGCTAAAGCTATGAGATCTTCTTCGCTAAACTCTGCTGCACCCGCTCTT
AATTCCAGCCTCTTTATTTGGGAAATGGATAGTAACAGCTTTGGTACTGGACATGCCGAGCGGCCAGTTGCTACAATATT
CAAGTTTCACAAGGCCATAAGCAAAGATCTAGAGTTTCTTGATGTTGAATCTGGAAAGCTCATTGATTGCGATGGGACAT
TTATTCGTCAATTTATCGGTCGATTTCACCTACTCTGGGGTTTCTACAAGGCTCATAGTAATGCAGAAGATGACATCCTA
TTTCCAGCTCTGGAATCGAAGGAGACGCTTCACAATGTCAGTCACTCTTACACGCTCGACCATAAACAGGAGGAGAAGTT
GTTTGGTGATATTTATAGTGTCCTTACTGAACTTTCAATTCTTCATGAGAAGTTACAGAGTGATTCTGTGATGGGGGACA
TAGCTCAAACTGACACTGTTCAGACTGATATCGATAACAGTGACTGCAAGAAGAAGTACAATGAACTGGCTACAAAGCTA
CAAGGGATGTGCAAATCCATTAAAATCACTTTGGATCAGCATATTTTCTTGGAGGAACTGGAGCTATGGCCTCTATTTGA
CAAACACTTCTCCATTCAAGAGCAAGACAAGATTGTGGGTCGTATAATCGGAACAACGGGTGCTGAAGTTCTCCAATCTA
TGTTACCATGGGTGACGTCTGCCCTTTCTGAAGATGAGCAAAACAGAATGATGGATACCTGGAAGCAGGCAACCAAGAAC
ACAATGTTCGATGAATGGCTTAATGAATGCTGGAAAGGATCACCCGACTCATCCTCAACAGAAACATCCAAACCTAGTCC
ACAGAAAGATAATGATCATCAAGAAATCTTGGACCAAACTGGTGAACTATTTAAGCCGGGGTGGAAAGATATTTTCCGCA
TGAATCAGAACGAACTAGAGGCTGAAATCAGGAAGGTTTATCAGGACTCAACACTTGATCCGAGGAGAAAAGATTATCTC
GTACAAAATTGGAGGACCAGTCGATGGATTGCGGCTCAGCAAAAGTTACCTAAGGAAACAGAAACTGCATTAAATGGTGA
AGTTGAACTTGGATGTTCCCCGTCTTTTCGAGATCCCGAGAAACAGATATATGGATGCGAGCATTACAAGCGTAACTGCA
AGCTTCGAGCTGCTTGTTGTGATCAGTTGTTCACTTGTAGGTTTTGCCATGACAAAGTAAGCGACCACTCCATGGATAGA
AAATTGGTGACGGAAATGCTCTGTATGCGGTGCCTCAAGGTGCAACCTGTTGGTCCCATCTGCACAACACCTTCATGCGA
CGGATTCCCAATGGCAAAGCACTATTGCAGTATTTGCAAACTTTTTGATGATGAAAGGGCTGTTTACCACTGTCCATTCT
GCAACCTTTGCCGGGTCGGGGAAGGACTAGGAATCGATTTTTTCCATTGCATGACATGTAACTGTTGCCTGGGGATGAAA
CTAGTAAACCACAAGTGCCTCGAGAAGAGCCTCGAGACAAATTGTCCCATTTGCTGCGAATTTCTTTTCACATCGAGTGA
AGCAGTTAGAGCCTTACCATGTGGTCACTACATGCACTCAGCTTGCTTCCAGGCTTACACTTGCAGCCACTACACATGTC
CAATCTGTGGAAAATCATTAGGAGATATGGCTGTTTATTTCGGTATGCTTGATGCACTGTTAGCTGCAGAAGAACTTCCA
GAGGAATATAAAAATCGCTGTCAGGACATTCTATGTAATGATTGTGAATGCAAAGGAACTACACGGTTCCATTGGTTGTA
CCATAAATGTGGTAGCTGTGGTTCTTACAATACCCGTGTGATCAAGTCCGAAACAACCCCCCCAGACTGCTCAACCTCAT
CCTGA