Details for Lyrate rockcress Locus 16054401

Position : sca3 ( 5`- 5693286 .. 5694482 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16054401

Protein [Map View]
MTTTMSNLPEVLVEEIISRVPITSLGSFRSSCKKWEALSKTHLLGGKAAEVTTRKQLLGFILVDDKICSMKLDLHGITKD
GDDFVDTSVNQVSALDLDELSISQIFHCDGLLLCVFSKRLMVCNMYLGQTRFIKPRRLFERFDKSGVYAFGYDDSSKNRN
HKILRNKSVGGGYEIYNFRSDSWKVLNVDLEEDTQLDQQGSLSLKGNAYFLVTKTFEETLEVGEDLEEAMVSEETEEFLL
CFDFTTERFGQLLSLPFHSEVDDDGVREDNVVLSCVRDEQLAVLHQSDTTIGIWISTEIEPNAVSWREFLEVDLTTVDGF
PDDFKAGSFFVDEEKQVAVVFDQETEAGGNHTACIIGKDGYFNSVNVGDIPPPYFTSYVPSLVSLQIKKKGKRKARDY*

DNA
ATGACGACGACGATGTCAAATCTTCCAGAGGTTTTGGTAGAAGAGATTATCTCCAGGGTTCCCATTACATCTCTTGGATC
ATTCCGATCAAGCTGTAAAAAATGGGAGGCTTTATCGAAAACCCATCTTTTAGGTGGTAAAGCAGCAGAAGTAACCACAA
GGAAGCAGTTACTAGGGTTTATCCTAGTTGATGACAAGATCTGTTCGATGAAACTCGATCTACATGGAATCACCAAAGAC
GGCGATGACTTTGTTGACACATCAGTGAATCAAGTAAGTGCACTTGATCTTGATGAATTGTCGATATCTCAAATCTTTCA
CTGCGACGGCTTATTGCTATGCGTCTTCAGCAAGAGGCTCATGGTGTGTAACATGTACTTGGGACAAACGAGGTTTATCA
AACCCCGTCGCTTGTTCGAGAGATTCGATAAATCAGGCGTGTATGCTTTCGGATATGATGATAGCAGCAAAAACCGTAAC
CACAAAATCTTGAGAAACAAGTCTGTTGGTGGTGGTTACGAAATCTATAATTTCAGATCCGATTCATGGAAGGTTCTTAA
TGTTGATCTCGAAGAAGATACACAGCTTGATCAACAAGGAAGCTTGTCTTTGAAGGGAAATGCTTACTTTTTGGTGACAA
AGACATTTGAAGAGACACTTGAAGTAGGAGAAGACTTAGAAGAAGCGATGGTATCAGAAGAGACTGAAGAATTTTTACTC
TGTTTTGACTTCACAACAGAGAGATTTGGACAGCTTCTGTCTCTGCCGTTTCACTCTGAAGTTGATGATGACGGAGTTCG
AGAAGACAATGTGGTTTTATCTTGTGTTAGAGATGAGCAGCTTGCCGTGTTACATCAAAGTGACACGACAATAGGTATTT
GGATTTCCACTGAGATCGAGCCCAATGCGGTGTCGTGGAGAGAGTTTTTGGAAGTGGACTTGACGACGGTTGATGGTTTT
CCGGATGACTTCAAAGCTGGGAGCTTCTTCGTTGACGAGGAGAAGCAAGTCGCCGTAGTTTTTGATCAAGAGACCGAGGC
CGGTGGCAACCACACAGCTTGCATCATTGGAAAAGATGGATACTTCAACTCTGTGAATGTTGGAGATATTCCGCCCCCAT
ACTTCACTTCTTATGTTCCAAGCTTAGTGTCATTGCAAATCAAGAAGAAGGGCAAAAGAAAAGCAAGAGATTATTAG