Details for Lyrate rockcress Locus 16054393

Position : sca3 ( 5`- 3367457 .. 3366342 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478147 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16054393

Protein [Map View]
MMMRKPDITTIRDKGKPNHACGGNNNKPKLRKGLWSPDEDEKLIRYMLTNGQGCWSDIARNAGLLRCGKSCRLRWINYLR
PDLKRGSFSPQEEDLIFHLHSILGNRWSQIATRLPGRTDNEIKNFWNSTLKKRLKNNNNNNNSSGSSPNNSNSNSLDPRD
QHVDMGGNSAPLMDGYHHDDNMMIVGNTMRMESSSSFNFAPVVNSVGLNQLDDPLMISVPDNQYHQMGNTGNVFNVNGLG
DYGNTILDPFSKRVSVEGDWFLPPSENTNVIACSTSNNLNLQVFDPCFNSKNVCHSESFKVGNVLGIENGSWEIENPKIG
DWDLDGLIDNNSSFPFLDFQVD*

DNA
ATGATGATGAGGAAACCGGACATTACTACGATCAGAGACAAGGGCAAGCCAAATCATGCATGTGGTGGTAATAACAACAA
ACCGAAGCTAAGAAAAGGACTTTGGTCGCCTGATGAAGACGAGAAGCTCATAAGATACATGTTGACTAATGGACAAGGAT
GTTGGAGTGACATCGCTAGAAATGCTGGTCTTTTACGTTGTGGTAAAAGTTGTCGCCTTCGCTGGATCAATTACTTGAGG
CCTGATCTTAAACGTGGCTCCTTCTCTCCTCAAGAAGAGGATCTCATCTTCCATTTGCATTCTATTCTTGGTAACAGGTG
GTCTCAAATAGCTACTCGGCTTCCAGGTAGGACAGACAACGAGATCAAAAACTTTTGGAACTCGACATTGAAGAAGAGGC
TTAAGAATAACAACAACAACAATAATTCATCAGGATCATCACCTAACAATAGTAATAGTAATTCCTTGGACCCAAGAGAT
CAACATGTGGATATGGGAGGCAACTCTGCTCCATTGATGGATGGCTATCACCATGATGACAACATGATGATAGTGGGGAA
TACAATGCGCATGGAATCTTCTTCCTCATTCAATTTTGCACCAGTGGTTAATAGTGTGGGCTTAAACCAGCTTGATGATC
CCCTGATGATATCAGTACCAGATAACCAATATCACCAAATGGGAAACACAGGGAATGTGTTCAACGTTAATGGCTTAGGA
GATTATGGAAACACAATTCTTGATCCATTTAGCAAGAGAGTATCAGTAGAAGGTGATTGGTTTCTTCCCCCCTCGGAGAA
TACCAATGTCATTGCTTGTAGTACAAGCAACAACCTAAACTTACAAGTCTTCGATCCTTGCTTCAATAGCAAAAATGTTT
GTCATTCAGAAAGCTTCAAGGTAGGGAATGTGTTGGGGATAGAGAATGGTTCTTGGGAAATAGAAAACCCTAAAATCGGA
GATTGGGATTTGGATGGTCTCATCGATAACAACTCTTCTTTCCCCTTCCTTGATTTCCAAGTCGATTGA