Details for Lyrate rockcress Locus 16054360

Position : sca3 ( 5`- 496781 .. 497242 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16054360

Protein [Map View]
MGKARGVNNGVNESSLGYLFGSGQPSSAAAATMGTTTTTTTTTTTDGTGGRPITTTTTTVTDNKKTSAGVRGSPNNYFRS
EGQNCGNFLTDRPSTKVHAAPGGGSSLDYLFGGPSPAGSGNK*

DNA
ATGGGTAAAGCAAGAGGAGTGAACAATGGTGTCAATGAAAGTTCTCTCGGTTATCTCTTTGGTTCCGGCCAGCCTTCTTC
CGCTGCTGCTGCCACAATGGGGACTACGACTACAACAACCACCACAACTACCACCGACGGAACCGGAGGGAGACCGATAA
CCACCACGACGACCACAGTCACTGATAACAAGAAGACATCTGCAGGTGTTAGAGGAAGTCCTAATAATTACTTCAGATCA
GAAGGCCAAAACTGTGGAAACTTTCTCACGGACAGGCCATCTACTAAGGTTCATGCAGCTCCTGGTGGTGGATCTTCTCT
TGATTATCTGTTCGGAGGACCAAGTCCTGCTGGATCTGGAAACAAATGA