Details for Lyrate rockcress Locus 16054333

Position : sca5 ( 5`- 17837361 .. 17833489 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16054333

Protein [Map View]
MAIASILASTQNPFLRLSQPPSPVSRSVVFRRYLEPCGRRWIPRSIRACQSSDKVSVSVTIPSLRLGGDGAISASAQRFH
FGKEFMSFVSDNFLPLALVSGVALGFANPTLGCLADKYSFTKISTCGIFIISGLTLRTEAIGAAVKGWPLGVFGLISILL
LTPSFSRLIMLVQLQPRELVTGLGIFCCMPTTLSSGVALTHLAGGNAALALAVTVASNLLGILTIPFWVSRYIAGGVGVS
FPTDQLFRSLIVTLLIPLIIGKVIRESFKGFANFVDNNRKLFSKINAICLSLVPWIQVSRSRSLLLSVKPKVFLAAVGIG
ILLHLSLLAFNAVSIRILSGVSGGSKNSKENTTAVLLVSSQKTLPVMVAVVEQLGGAFGETGLLVLPCVAAHLNQIMIDS
VLVNLWRRRGKDTSTGVKTA*

DNA
ATGGCGATAGCTAGTATCCTGGCTTCAACCCAAAACCCCTTTTTACGTCTAAGTCAACCACCATCTCCGGTGAGCCGCTC
CGTCGTCTTCCGCCGCTATCTTGAGCCCTGTGGCAGACGATGGATTCCCAGATCCATTAGAGCATGCCAATCTTCCGACA
AGGTCTCTGTATCTGTCACTATTCCAAGTTTGCGTCTTGGTGGTGACGGAGCCATTTCAGCTTCAGCTCAAAGATTTCAT
TTTGGCAAGGAATTTATGAGTTTTGTTTCAGATAATTTCTTGCCTCTAGCTCTTGTTAGTGGAGTGGCTTTGGGCTTTGC
AAATCCAACTCTAGGCTGTCTTGCTGACAAATACTCCTTCACTAAGATCAGCACATGTGGGATATTTATTATATCAGGGT
TGACTTTACGTACTGAAGCGATTGGTGCTGCTGTTAAAGGATGGCCTCTTGGAGTCTTCGGGCTAATCTCTATTTTGTTG
CTCACTCCATCCTTCTCAAGGCTAATTATGCTGGTCCAACTCCAACCTCGCGAACTTGTTACAGGGCTGGGTATATTTTG
CTGTATGCCAACCACCTTATCAAGTGGTGTTGCCCTTACTCACCTTGCTGGTGGCAATGCTGCTCTTGCTCTTGCTGTGA
CAGTGGCGTCTAACTTATTAGGAATTTTAACTATTCCATTTTGGGTATCAAGATACATAGCTGGGGGAGTAGGGGTTTCG
TTTCCTACTGACCAACTATTCAGAAGTCTTATAGTTACTTTGTTAATTCCTTTAATCATTGGCAAGGTTATTCGAGAATC
ATTCAAAGGTTTCGCAAACTTTGTTGACAATAACCGTAAACTCTTTTCGAAAATCAACGCAATCTGCCTCAGTTTGGTGC
CATGGATCCAAGTGAGCAGGTCAAGATCACTGCTACTATCCGTTAAGCCTAAGGTGTTTCTTGCTGCCGTTGGCATTGGA
ATATTGCTGCATCTTTCTCTACTAGCATTCAATGCTGTTTCAATCCGCATCCTCTCGGGTGTTTCAGGTGGTAGTAAGAA
CTCCAAGGAAAACACCACTGCAGTCTTGCTCGTTTCGAGCCAGAAAACATTACCTGTAATGGTGGCGGTAGTAGAGCAAT
TAGGAGGTGCATTTGGTGAGACAGGGCTTTTGGTTCTTCCATGTGTAGCTGCACACCTAAACCAGATCATGATTGATTCA
GTTCTTGTTAACTTATGGCGCAGGAGGGGTAAAGATACTTCGACTGGTGTAAAGACAGCCTGA