Details for Lyrate rockcress Locus 16054267

Position : sca3 ( 5`- 9931259 .. 9933288 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16054267

Protein [Map View]
MDENNRNPFASASTSARASGSTSASSNSSFSSSVADTDDDQTIARILAEDESLRREGKLGKRLSHLDSIPHTPRVNREIP
DINDATLDHELLSGRLATYGLAELQMEGDGNCQFRALADQLFRNADYHKHVRKHVVKQLKQQRKLYEEYVPMKYRHYTRK
MKKHGEWGDHVTLQAAADRFEAKICLVTSFRDQSYIEILPHNKNPLREAWLSFWSEVHYNSLYANGDVPTRKPRRKHWLF
*

DNA
ATGGATGAAAACAATAGGAATCCATTTGCAAGTGCAAGTACAAGTGCAAGAGCAAGCGGCAGTACAAGTGCGAGCTCTAA
CTCGAGTTTTAGTAGCAGTGTGGCGGATACAGATGATGATCAAACCATTGCACGTATATTAGCAGAAGATGAGAGCTTAA
GAAGAGAAGGCAAGCTTGGGAAGAGATTATCTCATTTGGATTCTATCCCACATACTCCTCGGGTTAACAGGGAAATACCC
GATATAAATGATGCAACATTAGACCATGAGCTGCTCTCTGGGAGGTTGGCTACATATGGGTTAGCCGAATTACAAATGGA
GGGAGATGGAAATTGCCAGTTTCGAGCTTTAGCAGACCAGCTTTTCCGGAATGCAGATTACCATAAACATGTAAGGAAGC
ATGTTGTAAAGCAGTTAAAACAACAACGGAAGTTATACGAAGAATATGTGCCAATGAAATACAGACACTACACCAGGAAG
ATGAAAAAACATGGTGAATGGGGAGATCATGTTACTCTTCAAGCTGCTGCAGATCGATTCGAAGCAAAGATCTGCTTAGT
CACATCCTTTCGGGATCAATCCTACATCGAGATTCTTCCTCACAACAAAAACCCTCTTAGAGAGGCTTGGCTTAGCTTCT
GGAGTGAAGTGCATTACAATTCGCTATACGCTAACGGAGATGTCCCAACAAGAAAACCCAGAAGGAAGCATTGGCTCTTC
TAG