Details for Lyrate rockcress Locus 16054252

Position : sca3 ( 5`- 5406421 .. 5408346 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16054252

Protein [Map View]
MPPTMSCLIPKTVFIFLVTCFVCLGPYAHARSLNSPVMEETNPLIKTTKVAEENNEKNLQVNIIYGGKGHDAPLPPKTPI
NIIYGSYKSGPDGSGKGHDAPLPPKTQMNIIYGGYKSGPDGSGKGHDAPLPPKTTLNIIYGSYKSGPDGSGKGHDAPLPP
KTPMNIIYGGYKSGPDGSGKGHDAPLPPKTPMNIIYGGYKRKAHDAPLPPKTPMNIIYGGYKSGPDVSGKGHDAPLPPKT
PINIIYGSYKSGPDGSGKGHDAPLPPKTPMNIIYVPDDQGNGHGSPSPRV*

DNA
ATGCCTCCCACAATGTCTTGTTTGATTCCCAAAACAGTTTTCATATTCCTTGTCACTTGTTTTGTGTGTCTTGGACCTTA
TGCCCATGCAAGAAGTTTGAATTCACCCGTCATGGAAGAAACCAACCCGCTCATAAAAACGACAAAGGTTGCAGAGGAAA
ACAACGAGAAGAATTTACAAGTAAATATCATTTACGGAGGAAAAGGCCACGATGCACCGTTACCACCAAAAACACCGATA
AATATAATCTATGGAAGTTATAAAAGTGGACCTGATGGTTCAGGAAAAGGCCACGATGCACCGTTACCACCGAAAACACA
GATGAATATAATCTATGGAGGTTATAAAAGTGGACCTGATGGTTCAGGAAAAGGCCACGATGCACCGTTACCACCAAAAA
CAACTTTAAATATAATCTATGGAAGTTATAAAAGTGGACCTGATGGTTCAGGAAAAGGCCACGATGCACCGTTACCACCG
AAAACACCGATGAATATAATCTATGGAGGTTATAAAAGTGGACCTGATGGTTCAGGAAAAGGCCACGATGCACCGTTACC
ACCAAAAACACCGATGAATATAATCTATGGAGGTTATAAAAGAAAAGCCCACGATGCACCGTTACCACCAAAAACACCGA
TGAATATAATCTATGGAGGTTATAAAAGTGGACCTGATGTTTCAGGAAAAGGCCACGATGCACCGTTACCACCAAAAACA
CCGATAAATATAATCTATGGAAGTTATAAAAGTGGACCTGATGGTTCAGGAAAAGGCCACGATGCACCGTTACCACCGAA
AACACCGATGAATATAATTTATGTACCTGATGATCAAGGCAATGGTCACGGTTCACCGTCACCTCGTGTTTAA