Details for Lyrate rockcress Locus 16054234

Position : sca1 ( 5`- 7672540 .. 7673352 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16054234

Protein [Map View]
METVRFAVAVAVVLVFCAVTSSNAQTTPPSGGAGGDAHSLPCIQKLMPCQPYLHLVTPPPASCCMPLNEIVAKDATCLCA
VFNNVDMLKSLNLTKENALDLPKACGAKADVSLCKTSAGTNSSSTPPATPKTPPASSTSTGTGSGSTGDAASSTAKPTSS
APAINFGGLSFASAVVATLFF*

DNA
ATGGAGACTGTTAGATTCGCCGTCGCCGTCGCCGTCGTTCTTGTATTTTGCGCCGTTACGTCGTCTAATGCACAGACTAC
ACCACCGAGTGGCGGTGCAGGAGGAGACGCACACTCACTGCCGTGTATTCAGAAACTGATGCCGTGTCAGCCGTATCTTC
ACTTGGTGACTCCGCCGCCGGCGTCGTGTTGCATGCCGTTGAATGAGATCGTAGCCAAAGACGCGACGTGTCTCTGCGCC
GTCTTCAACAACGTCGATATGCTCAAATCGCTTAACCTCACTAAAGAAAACGCTCTCGATCTCCCCAAAGCTTGTGGCGC
CAAAGCTGACGTGTCACTATGCAAAACCAGCGCCGGAACTAATTCGTCTTCAACACCGCCGGCAACCCCCAAAACTCCTC
CAGCATCTTCCACCAGTACCGGAACAGGAAGCGGTTCAACCGGAGATGCAGCTTCTTCGACGGCCAAACCAACAAGCTCA
GCTCCGGCCATCAACTTCGGTGGACTTAGCTTTGCATCGGCTGTCGTGGCAACACTCTTCTTCTGA